Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01369 |
NCBI Accession ID | NC_017502.1 |
Organism | Mycoplasma gallisepticum R(high) |
Left | 874264 |
Right | 874566 |
Strand | - |
Nucleotide Sequence | ATGAAACACATAACTAATAAAGCAGAACTAGACCAATTATTAAGCACCAACAAGAAAGTTGTTGTTGATTTTTATGCTAACTGATGTGGTCCTTGCAAAATTTTAGGTCCGATCTTTGAAGAAGTAGCTCAAGACAAAAAGGACTGAACATTTGTTAAAGTAGATGTTGATCAAGCAAATGAGATCTCATCTGAATACGAAATCAGATCAATTCCAACGGTAATCTTTTTCCAAGATGGAAAGATGGCTGACAAAAGAATTGGTTTCATTCCTAAAAACGAATTAAAAGAATTGTTGAAATAA |
Sequence | MKHITNKAELDQLLSTNKKVVVDFYANWCGPCKILGPIFEEVAQDKKDWTFVKVDVDQANEISSEYEIRSIPTVIFFQDGKMADKRIGFIPKNELKELLK |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of cl00388. Profile Description: Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold. Thioredoxins are small enzymes that participate in redox reactions, via the reversible oxidation of an active centre disulfide bond. |
Pubmed ID | 30796087 |
Domain | CDD:412351 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 100 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 132909 | 133217 | + | NZ_CP012357.1 | Spiroplasma litorale |
2 | 2110926 | 2111240 | + | NZ_CP063145.1 | Cruoricaptor ignavus |
3 | 2825081 | 2825335 | + | NZ_CP033924.1 | Chryseobacterium lactis |
4 | 2564983 | 2565300 | + | NZ_CP033932.1 | Chryseobacterium bernardetii |
5 | 4989486 | 4989803 | + | NZ_LR134289.1 | Chryseobacterium gleum |
6 | 2819244 | 2819555 | - | NZ_CP017253.2 | Clostridium taeniosporum |
7 | 3891090 | 3891401 | - | NZ_CP013019.1 | Clostridium pasteurianum |
8 | 3774340 | 3774597 | - | NZ_CP014136.1 | Gibbsiella quercinecans |
9 | 2294961 | 2295215 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
10 | 4086132 | 4086386 | + | NZ_LT906479.1 | Serratia ficaria |
11 | 356209 | 356532 | - | NZ_CP027432.2 | Caminibacter pacificus |
12 | 1346725 | 1346979 | + | NZ_CP016538.2 | Planococcus maritimus |
13 | 1358169 | 1358423 | + | NZ_CP059540.1 | Planococcus maritimus |
14 | 1473094 | 1473408 | + | NZ_LS483476.1 | Lederbergia lentus |
15 | 543476 | 543730 | + | NC_010644.1 | Elusimicrobium minutum Pei191 |