Result : EXP01366
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01366 |
| NCBI Accession ID | NC_017340.1 |
| Organism | Staphylococcus aureus 04-02981 |
| Left | 1110604 |
| Right | 1110894 |
| Strand | + |
| Nucleotide Sequence | ATGGAGGGTTCAACAATGGAATATGAGTATCCAATTGATTTAGACTGGAGTAATGAAGAGATGATTTCAGTGATAAATTTCTTTAATCATGTAGAGAAGTATTATGAATCCGGCGTGACGGCAGGCGACTTTATGGGTGCATATAAAAGATTTAAAGAAATTGTGCCTGCTAAAGCAGAGGAAAAACAAATTTTTAATACTTTCGAAAAAAGTAGTGGCTATAATAGTTACAAAGCAGTTCAAGATGTAAAAACTCACTCTGAAGAACAAAGAGTAACAGCTAAAAAATAA |
| Sequence | MEGSTMEYEYPIDLDWSNEEMISVINFFNHVEKYYESGVTAGDFMGAYKRFKEIVPAKAEEKQIFNTFEKSSGYNSYKAVQDVKTHSEEQRVTAKK |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl23825. Profile Description: Uncharacterized protein family (UPF0223). hypothetical protein; Provisional |
| Pubmed ID | 30796087 |
| Domain | CDD:420035 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | Q5HQ72 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 68
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1013446 | 1013736 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1083646 | 1083918 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 1061967 | 1062242 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 405634 | 405909 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 5 | 769487 | 769759 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 6 | 218819 | 219091 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 7 | 1913222 | 1913491 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 8 | 2256671 | 2256946 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 9 | 1724024 | 1724299 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 10 | 69821 | 70093 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 11 | 1842390 | 1842662 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 12 | 1750174 | 1750407 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 13 | 900982 | 901260 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 14 | 1059287 | 1059559 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 15 | 1791215 | 1791448 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 16 | 1584612 | 1584845 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 17 | 1148309 | 1148542 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 18 | 1918698 | 1918973 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 19 | 1755779 | 1756057 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 20 | 849592 | 849864 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 21 | 697908 | 698156 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 22 | 282280 | 282564 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 23 | 1382544 | 1382813 | + | NZ_CP040336.1 | Bacillus luti |
| 24 | 1587529 | 1587816 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 25 | 3989195 | 3989464 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 26 | 3822507 | 3822776 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 27 | 3982309 | 3982578 | - | NC_011725.1 | Bacillus cereus B4264 |
| 28 | 792798 | 793046 | - | NZ_CP023392.1 | Lactococcus raffinolactis |
| 29 | 1337063 | 1337332 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 30 | 97962 | 98231 | - | NZ_CP043404.1 | Bacillus safensis |
| 31 | 496746 | 497027 | + | NZ_CP014835.1 | Streptococcus halotolerans |
| 32 | 1040076 | 1040357 | - | NZ_CP025536.1 | Streptococcus pluranimalium |
| 33 | 1435712 | 1435981 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 34 | 1083080 | 1083358 | + | NZ_LR594049.1 | Streptococcus gordonii |
| 35 | 1985648 | 1985929 | - | NZ_CP065637.1 | Lactococcus garvieae |
| 36 | 1568408 | 1568662 | + | NZ_CP027770.1 | Staphylococcus felis |
| 37 | 1164583 | 1164852 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 38 | 643065 | 643346 | + | NZ_CP070872.1 | Lactococcus taiwanensis |
| 39 | 1230481 | 1230762 | + | NZ_CP012024.1 | Bacillus smithii |
| 40 | 1125407 | 1125661 | - | NZ_CP012805.1 | Streptococcus anginosus |
| 41 | 2695302 | 2695547 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 42 | 1656070 | 1656321 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 43 | 1641853 | 1642104 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 44 | 488191 | 488478 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 45 | 665745 | 665978 | - | NZ_CP014163.1 | Aerococcus urinaehominis |
| 46 | 1664461 | 1664712 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 47 | 12746 | 13033 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 48 | 1190912 | 1191166 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 49 | 918242 | 918511 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 50 | 1581109 | 1581387 | + | NZ_CP016953.1 | Streptococcus himalayensis |
| 51 | 598331 | 598585 | + | NZ_LT906439.1 | Streptococcus merionis |
| 52 | 1921171 | 1921443 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 53 | 1074699 | 1074953 | - | NZ_CP034543.1 | Streptococcus periodonticum |
| 54 | 1091981 | 1092229 | - | NZ_CP032621.1 | Streptococcus gwangjuense |
| 55 | 2275338 | 2275634 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 56 | 16006 | 16281 | + | NZ_CP032627.1 | Lactococcus allomyrinae |
| 57 | 3886035 | 3886322 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 58 | 893750 | 894037 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 59 | 3775907 | 3776194 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 60 | 1217486 | 1217734 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 61 | 1334098 | 1334346 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 62 | 1393448 | 1393726 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 63 | 1030572 | 1030850 | - | NZ_CP014699.1 | Streptococcus pantholopis |
| 64 | 277332 | 277610 | - | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 65 | 1179649 | 1179897 | - | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 66 | 519577 | 519822 | + | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 67 | 1307097 | 1307378 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 68 | 1536470 | 1536739 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP022983.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00459.27 | 0.65 | 44 | 419.0 | same-strand | Inositol monophosphatase family |
++ More..