Result : EXP01365
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01365 |
| NCBI Accession ID | NZ_CP001668.1 |
| Organism | Mycoplasma mycoides subsp. capri LC str. 95010 |
| Left | 444531 |
| Right | 444803 |
| Strand | + |
| Nucleotide Sequence | ATGACTAAAAAAGAATTAATCGAAGAAATCATTATTAATGAAAATATTTCTAAAGTTGATGCAGAAAAAGTTGTTAATAGAATCTTTCAAACAATTTCAAAACATTTAATTGATGGAAAAGAAGTATCAGTTGCCGGATTTGGAAAATTTGTTATTTCTGAAAGAGCATCTAGAGAAGGAGTTAACCCATCAACTGGTGAAAAAATAGTTATTCCAGCTTCTAGATCAGCAAGATTTAAACCAGCAAAACAACTTAAAGAATCATTAATGTAA |
| Sequence | MTKKELIEEIIINENISKVDAEKVVNRIFQTISKHLIDGKEVSVAGFGKFVISERASREGVNPSTGEKIVIPASRSARFKPAKQLKESLM |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00257. Profile Description: DNA sequence specific (IHF) and non-specific (HU) domains. This model describes a set of proteins related to but longer than DNA-binding protein HU. Its distinctive domain architecture compared to HU and related histone-like DNA-binding proteins justifies the designation as superfamily. Members include, so far, one from Bacteroides fragilis, a gut bacterium, and ten from Porphyromonas gingivalis, an oral anaerobe. [DNA metabolism, Chromosome-associated proteins] |
| Pubmed ID | 30796087 |
| Domain | CDD:412265 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 41
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 444531 | 444803 | + | NZ_CP001668.1 | Mycoplasma mycoides subsp. capri str. GM12 |
| 2 | 687004 | 687276 | - | NC_007633.1 | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
| 3 | 377232 | 377510 | - | NC_007633.1 | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
| 4 | 600547 | 600822 | - | NZ_CP025257.1 | Mesoplasma syrphidae |
| 5 | 449323 | 449598 | - | NZ_CP007520.1 | Mycoplasma yeatsii GM274B |
| 6 | 315861 | 316133 | - | NZ_CP024964.1 | Entomoplasma melaleucae |
| 7 | 231859 | 232131 | + | NZ_CP024969.1 | Mesoplasma tabanidae |
| 8 | 227763 | 228035 | + | NC_006055.1 | Mesoplasma florum L1 |
| 9 | 232208 | 232480 | + | NZ_CP024411.1 | Mesoplasma entomophilum |
| 10 | 245201 | 245473 | + | NZ_CP023173.1 | Mesoplasma chauliocola |
| 11 | 463968 | 464246 | + | NZ_LS991954.1 | Mycoplasma putrefaciens |
| 12 | 292272 | 292547 | + | NZ_CP017015.1 | Spiroplasma helicoides |
| 13 | 478753 | 479028 | + | NZ_CP043026.1 | Spiroplasma chinense |
| 14 | 954149 | 954424 | - | NZ_CP022535.1 | Spiroplasma corruscae |
| 15 | 343815 | 344093 | + | NZ_CP038013.1 | Spiroplasma gladiatoris |
| 16 | 410169 | 410447 | + | NZ_CP046276.1 | Spiroplasma tabanidicola |
| 17 | 916730 | 917005 | - | NZ_CP012357.1 | Spiroplasma litorale |
| 18 | 1007970 | 1008245 | - | NZ_CP012328.1 | Spiroplasma turonicum |
| 19 | 840949 | 841221 | - | NZ_CP024963.1 | Entomoplasma luminosum |
| 20 | 349692 | 349967 | + | NC_022998.1 | Spiroplasma apis B31 |
| 21 | 1227355 | 1227639 | - | NZ_CP013197.1 | Spiroplasma citri |
| 22 | 813153 | 813425 | - | NC_021284.1 | Spiroplasma syrphidicola EA-1 |
| 23 | 663287 | 663559 | - | NZ_CP024962.1 | Entomoplasma freundtii |
| 24 | 1178281 | 1178556 | - | NZ_CP024870.1 | Spiroplasma clarkii |
| 25 | 804632 | 804904 | - | NC_021280.1 | Spiroplasma chrysopicola DF-1 |
| 26 | 1404715 | 1404999 | - | NZ_CP031088.1 | Spiroplasma phoeniceum P40 |
| 27 | 306314 | 306589 | + | NZ_CP012622.1 | Spiroplasma cantharicola |
| 28 | 293859 | 294134 | + | NC_021846.1 | Spiroplasma taiwanense CT-1 |
| 29 | 287224 | 287502 | + | NZ_CP006934.1 | Spiroplasma sabaudiense Ar-1343 |
| 30 | 352969 | 353244 | + | NZ_CP006681.1 | Spiroplasma culicicola AES-1 |
| 31 | 861242 | 861520 | - | NZ_CP031376.1 | Spiroplasma alleghenense |
| 32 | 281955 | 282230 | + | NC_021833.1 | Spiroplasma diminutum CUAS-1 |
| 33 | 269757 | 270032 | + | NZ_CP025543.1 | Spiroplasma monobiae MQ-1 |
| 34 | 170782 | 171057 | + | NZ_CP023668.1 | Mesoplasma lactucae ATCC 49193 |
| 35 | 361071 | 361346 | + | NZ_CP025057.1 | Spiroplasma floricola 23-6 |
| 36 | 2709770 | 2710045 | + | NZ_CP012401.1 | Azospirillum thiophilum |
| 37 | 1619424 | 1619699 | - | NZ_CP054619.1 | Azospirillum oryzae |
| 38 | 1075991 | 1076266 | + | NZ_CP029829.1 | Azospirillum ramasamyi |
| 39 | 855191 | 855463 | - | NZ_CP002082.1 | Spiroplasma mirum ATCC 29335 |
| 40 | 883082 | 883354 | - | NZ_CP011855.1 | Spiroplasma atrichopogonis |
| 41 | 1051950 | 1052222 | - | NZ_CP011856.1 | Spiroplasma eriocheiris |
| 42 | 544634 | 544906 | - | NZ_CP024965.1 | Entomoplasma somnilux |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP024964.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01926.25 | 0.76 | 31 | 1453 | same-strand | 50S ribosome-binding GTPase |
| 2 | PF01210.25 | 0.76 | 31 | 21 | same-strand | NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus |
| 3 | PF07479.16 | 0.73 | 30 | 21.0 | same-strand | NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus |
| 4 | PF03807.19 | 0.68 | 28 | 21.0 | same-strand | NADP oxidoreductase coenzyme F420-dependent |
++ More..