Result : EXP01361
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01361 |
| NCBI Accession ID | NZ_CP001668.1 |
| Organism | Mycoplasma mycoides subsp. capri LC str. 95010 |
| Left | 382445 |
| Right | 382744 |
| Strand | - |
| Nucleotide Sequence | ATGCAAAAAGATAAATTACTAAAAGCTATTGGAATGGCATACACTTCTAATAACCTAATAACTGGATTTAGATTACTTGAAGAAATTAAATTAAAAAAAGTTAAATTTGTAATTTTAAGTTCAGATATGGGATTAGCACAACAAAAAAAATATATCAATAAATGTCTTTCAAGAAATATCGAATGTGTTTTTAATGTTTTAACAAAACAAGAATTAGCAAAAGCATGTGGAAAAGATATTTTAGTAGCTATTGGATTAAAAGATGATAACTTTATCAAATTAATCAAATCTAATTTATAG |
| Sequence | MQKDKLLKAIGMAYTSNNLITGFRLLEEIKLKKVKFVILSSDMGLAQQKKYINKCLSRNIECVFNVLTKQELAKACGKDILVAIGLKDDNFIKLIKSNL |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00600. Profile Description: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family. This RNA binding Pelota domain is at the C-terminus of a PRTase family. These PRTase+Pelota genes are found in the biosynthetic operon associated with the Ter stress-response operon and are predicted to be involved in the biosynthesis of a ribo-nucleoside involved in stress response. |
| Pubmed ID | 30796087 |
| Domain | CDD:412466 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 382445 | 382744 | - | NZ_CP001668.1 | Mycoplasma mycoides subsp. capri str. GM12 |
| 2 | 398931 | 399230 | - | NC_007633.1 | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
| 3 | 246961 | 247260 | + | NZ_CP007520.1 | Mycoplasma yeatsii GM274B |
| 4 | 530132 | 530431 | - | NZ_LS991954.1 | Mycoplasma putrefaciens |
| 5 | 359956 | 360255 | + | NZ_CP023173.1 | Mesoplasma chauliocola |
| 6 | 352498 | 352797 | + | NZ_CP024969.1 | Mesoplasma tabanidae |
| 7 | 338556 | 338855 | + | NC_006055.1 | Mesoplasma florum L1 |
| 8 | 348876 | 349175 | + | NZ_CP024411.1 | Mesoplasma entomophilum |
| 9 | 392572 | 392871 | + | NZ_CP024964.1 | Entomoplasma melaleucae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP001668.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00009.29 | 1.0 | 9 | 19 | same-strand | Elongation factor Tu GTP binding domain |
| 2 | PF11987.10 | 1.0 | 9 | 19 | same-strand | Translation-initiation factor 2 |
| 3 | PF01926.25 | 1.0 | 9 | 19 | same-strand | 50S ribosome-binding GTPase |
| 4 | PF04760.17 | 1.0 | 9 | 19 | same-strand | Translation initiation factor IF-2, N-terminal region |
| 5 | PF00071.24 | 1.0 | 9 | 19 | same-strand | Ras family |
| 6 | PF04296.15 | 1.0 | 9 | -13 | same-strand | Protein of unknown function (DUF448) |
++ More..