Result : B2THN3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0473 protein CLL_A1177 |
| NCBI Accession ID | CP001056.1 |
| Organism | Clostridium botulinum (strain Eklund 17B / Type B) |
| Left | 1204669 |
| Right | 1204935 |
| Strand | + |
| Nucleotide Sequence | ATGCAAAAAGACGTAGAATATATAGAATTATTAGATGAACAAGGAGAACAAATTAAATTTAAGGTAATAACTTATTTCCAAATAGACGAAATAAATGGGGAATATGTTGTAGTGACTCCAGCAGAAAATGATGAATGTGATGAAGCATTTGTATTAAAAGTTATATCTGATGAAGATGGCAATGAAACTCTTGTTTCAATAGAAGATGAAAAAGAATTTGATTTAGTTGAAGAAGCATATAATCTTGTTATGTCAGAACAAGACTAA |
| Sequence | MQKDVEYIELLDEQGEQIKFKVITYFQIDEINGEYVVVTPAENDECDEAFVLKVISDEDGNETLVSIEDEKEFDLVEEAYNLVMSEQD |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01608. Profile Description: Protein of unknown function (DUF1292). hypothetical protein; Provisional |
| Pubmed ID | |
| Domain | CDD:412983 |
| Functional Category | Others |
| Uniprot ID | B2THN3 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1128978 | 1129244 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 2 | 1448315 | 1448575 | + | NZ_CP014204.2 | Clostridium baratii |
| 3 | 1704367 | 1704630 | + | NZ_CP040924.1 | Clostridium thermarum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP017253.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05239.18 | 0.67 | 2 | 5003.0 | same-strand | PRC-barrel domain |
| 2 | PF01594.18 | 1.0 | 3 | 3881 | same-strand | AI-2E family transporter |
| 3 | PF01411.21 | 1.0 | 3 | 957 | same-strand | tRNA synthetases class II (A) |
| 4 | PF02272.21 | 1.0 | 3 | 957 | same-strand | DHHA1 domain |
| 5 | PF07973.16 | 1.0 | 3 | 957 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
| 6 | PF06135.14 | 1.0 | 3 | 542 | same-strand | IreB regulatory phosphoprotein |
| 7 | PF03652.17 | 1.0 | 3 | 75 | same-strand | Holliday junction resolvase |
| 8 | PF01475.21 | 1.0 | 3 | 23 | same-strand | Ferric uptake regulator family |
| 9 | PF17770.3 | 1.0 | 3 | 554 | same-strand | Ribonuclease J C-terminal domain |
| 10 | PF07521.14 | 0.67 | 2 | 525.5 | same-strand | Zn-dependent metallo-hydrolase RNA specificity domain |
| 11 | PF00009.29 | 1.0 | 3 | 2398 | same-strand | Elongation factor Tu GTP binding domain |
| 12 | PF00679.26 | 1.0 | 3 | 2398 | same-strand | Elongation factor G C-terminus |
| 13 | PF03144.27 | 1.0 | 3 | 2398 | same-strand | Elongation factor Tu domain 2 |
| 14 | PF01926.25 | 1.0 | 3 | 2398 | same-strand | 50S ribosome-binding GTPase |
| 15 | PF02618.18 | 1.0 | 3 | 4325 | same-strand | YceG-like family |
| 16 | PF01596.19 | 1.0 | 3 | 5355 | same-strand | O-methyltransferase |
| 17 | PF13578.8 | 1.0 | 3 | 5355 | same-strand | Methyltransferase domain |
| 18 | PF08241.14 | 0.67 | 2 | 5370.0 | same-strand | Methyltransferase domain |
| 19 | PF13649.8 | 0.67 | 2 | 5288.5 | same-strand | Methyltransferase domain |
++ More..