Result : EXP01357
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01357 |
| NCBI Accession ID | NC_007633.1 |
| Organism | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
| Left | 100483 |
| Right | 100782 |
| Strand | + |
| Nucleotide Sequence | ATGGGAATTAAATTAAAAATTTTAACACCTAATGGTGCTTTTGTTGAAGATAAAGAAGTAGATATAATTAATCTTAAAACTATTGATGGAGACATTGGAGTATTAGAAAATATGGCTCCATTTGTAACAGCTTTAAGAAATGATACTTTAAGTTTTAAAGAAAAAAATAAATACACTTATATTCATCTTGATCAAGGTCTAGTATTTATTAATAGTAAAGAATGTAAAATTATTACTGAAAAATTATATCTTGTAGATAAACAAGATAAAGAATTAGCTACTCCTTTAAAATTAATATAA |
| Sequence | MGIKLKILTPNGAFVEDKEVDIINLKTIDGDIGVLENMAPFVTALRNDTLSFKEKNKYTYIHLDQGLVFINSKECKIITEKLYLVDKQDKELATPLKLI |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl29826. Profile Description: mitochondrial ATP synthase delta subunit. Part of the ATP synthase CF(1). These subunits are part of the head unit of the ATP synthase. The subunit is called epsilon in bacteria and delta in mitochondria. In bacteria the delta (D) subunit is equivalent to the mitochondrial Oligomycin sensitive subunit, OSCP (pfam00213). |
| Pubmed ID | 30796087 |
| Domain | CDD:421925 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 100483 | 100782 | + | NC_007633.1 | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
| 2 | 935495 | 935794 | - | NZ_CP001668.1 | Mycoplasma mycoides subsp. capri str. GM12 |
| 3 | 847092 | 847391 | - | NZ_CP025257.1 | Mesoplasma syrphidae |
| 4 | 164641 | 164940 | + | NZ_CP007520.1 | Mycoplasma yeatsii GM274B |
| 5 | 639587 | 639886 | - | NZ_CP023668.1 | Mesoplasma lactucae ATCC 49193 |
| 6 | 776161 | 776460 | - | NZ_CP024965.1 | Entomoplasma somnilux |
| 7 | 88130 | 88429 | + | NZ_LS991954.1 | Mycoplasma putrefaciens |
| 8 | 132717 | 133016 | - | NZ_CP024963.1 | Entomoplasma luminosum |
| 9 | 776701 | 777000 | - | NZ_CP024962.1 | Entomoplasma freundtii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007633.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00006.27 | 1.0 | 9 | 15 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
| 2 | PF02874.25 | 1.0 | 9 | 18.0 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
++ More..