| Protein name |
EXP01356 |
| NCBI Accession ID |
NC_007633.1 |
| Organism |
Mycoplasma capricolum subsp. capricolum ATCC 27343 |
| Left |
825444 |
| Right |
825740 |
| Strand |
- |
| Nucleotide Sequence |
ATGTCAAATAGATTTAATAAAGAATTTTGAAAAGAATTAGCTCATGATTTTATGTTTGAACTAAATGATGAAGAACTTGAAAATTTAATGAGTGTTGAAGATAAACTTTTTGATGATTTTAAAAAAATCACTAGTATTGATACAACTGGAGTTGAACCAACTTTTTATACAATTAATCAAATTCATTCTTATTTAAGAGAAGATGTTGTGGTTCAAACAAACACACAAAAAGAAATTTTAGAAAATGCACCAACTAAACATGATAATTACATCACAATAGCAAGGGTGGTTAAATAA |
| Sequence |
MSNRFNKEFWKELAHDFMFELNDEELENLMSVEDKLFDDFKKITSIDTTGVEPTFYTINQIHSYLREDVVVQTNTQKEILENAPTKHDNYITIARVVK |
| Source of smORF |
Protein-level |
| Function |
The ORF matches to the profile of cl00495. Profile Description: Glu-tRNAGln amidotransferase C subunit. This model represents a family small family related to GatC, the third subunit of an enzyme for completing the charging of tRNA(Gln) by amidating the Glu-tRNA(Gln). The few known archaea that contain a member of this family appear to produce Asn-tRNA(Asn) by an analogous amidotransferase reaction. This protein is proposed to substitute for GatC in the charging of both tRNAs. |
| Pubmed ID |
30796087
|
| Domain |
CDD:412411 |
| Functional Category |
Conserved domain based functional assignment |
| Uniprot ID |
|
| ORF Length (Amino Acid) |
98 |