Result : EXP01353
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01353 |
| NCBI Accession ID | NC_000911.1 |
| Organism | Synechocystis |
| Left | 2138496 |
| Right | 2138621 |
| Strand | + |
| Nucleotide Sequence | ATGACTATTGAAGAGGTTTTGGATGATTTCCCTGATCTCACTCCAGAAGATATCCAGGCTTGTTTTGCCTTTGCTGCTGATCGTGATCGTCGCCTCATGGTTGTTCCTGATGAAATTGCTGTTTGA |
| Sequence | MTIEEVLDDFPDLTPEDIQACFAFAADRDRRLMVVPDEIAV |
| Source of smORF | Literature |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 36
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3155115 | 3155240 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 2 | 3882643 | 3882756 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 3 | 2557405 | 2557530 | + | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 4 | 776951 | 777070 | - | NC_014221.1 | Truepera radiovictrix DSM 17093 |
| 5 | 3314522 | 3314641 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 6 | 3747482 | 3747601 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 7 | 3333561 | 3333674 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 8 | 257738 | 257857 | - | NZ_CP054697.1 | Nostoc edaphicum CCNP1411 |
| 9 | 1788655 | 1788768 | + | NC_014212.1 | Meiothermus silvanus DSM 9946 |
| 10 | 3897648 | 3897758 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 11 | 535101 | 535214 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 12 | 1745399 | 1745512 | - | NZ_CP010904.1 | Kiritimatiella glycovorans |
| 13 | 3451620 | 3451733 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 14 | 102756 | 102869 | - | NC_009767.1 | Roseiflexus castenholzii DSM 13941 |
| 15 | 3436982 | 3437095 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 16 | 4598010 | 4598129 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 17 | 7645432 | 7645545 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 18 | 3663794 | 3663907 | + | NZ_CP007139.1 | Fimbriimonas ginsengisoli Gsoil 348 |
| 19 | 677863 | 677976 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 20 | 2542704 | 2542820 | + | NZ_CP011801.1 | Nitrospira moscoviensis |
| 21 | 104621 | 104734 | - | NC_019772.1 | Anabaena cylindrica PCC 7122 |
| 22 | 6797566 | 6797703 | - | NZ_CP030053.1 | Bradyrhizobium guangzhouense |
| 23 | 3581162 | 3581281 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 24 | 4605795 | 4605908 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 25 | 997006 | 997125 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 26 | 3076791 | 3076898 | - | NZ_CP040106.1 | Echinicola rosea |
| 27 | 3118426 | 3118533 | - | NZ_CP040106.1 | Echinicola rosea |
| 28 | 662224 | 662337 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 29 | 726655 | 726771 | - | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 30 | 3549160 | 3549279 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 31 | 3111051 | 3111170 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 32 | 1786693 | 1786806 | - | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 33 | 2437549 | 2437662 | + | NZ_CP014263.1 | Spirosoma montaniterrae |
| 34 | 607806 | 607925 | + | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 35 | 1135804 | 1135917 | - | NZ_CP010554.1 | Rugosibacter aromaticivorans |
| 36 | 586806 | 586925 | + | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 37 | 3833820 | 3833927 | - | NZ_CP042437.1 | Mucilaginibacter ginsenosidivorax |
| 38 | 1726453 | 1726572 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 39 | 569857 | 569970 | + | NC_007484.1 | Nitrosococcus oceani ATCC 19707 |
| 40 | 2221509 | 2221628 | - | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 41 | 2208768 | 2208893 | + | NC_013501.1 | Rhodothermus marinus DSM 4252 |
| 42 | 1418555 | 1418665 | + | NZ_CP019044.1 | Salaquimonas pukyongi |
| 43 | 344858 | 344962 | - | NZ_LR134476.1 | Trueperella bialowiezensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010296.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF18480.3 | 0.67 | 24 | -3.0 | same-strand | Domain of unknown function (DUF5615) |
++ More..