Result : A0QRX9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin Phd |
| NCBI Accession ID | CP000480.1 |
| Organism | Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) |
| Left | 1365336 |
| Right | 1365533 |
| Strand | + |
| Nucleotide Sequence | ATGCCGTCGCTGAACATCGACTTCGACGAAGCCGAGATGGAACAGATCCGCGCTGCTGCCCGGGCGGATGACCTGTCGCTGAAGAAGTTCGCGCACGCCGCCGTGATGGAGCGTGCCAGCGCGCACAAGCGCAGGGTCGCCGAGGCGGCGCGTCTGGTCGCTGAGCGTTCGGCTGAGCTCAACCGCCGCTTGGCGTGA |
| Sequence | MPSLNIDFDEAEMEQIRAAARADDLSLKKFAHAAVMERASAHKRRVAEAARLVAERSAELNRRLA |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Neutralizes the bacteriostatic effect of cognate toxin Doc. In M.smegmatis 3 TA systems (VapB-VapC, MazE-MazF and Phd-Doc) may be involved in monitoring the nutritional supply and physiological state of the cell, linking catabolic with anabolic reactions. {ECO:0000269|Pubmed:22199354}. |
| Pubmed ID | 17295914 18955433 22199354 |
| Domain | |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | A0QRX9 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1429130 | 1429327 | + | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 2 | 2570487 | 2570684 | - | NZ_AP022565.1 | Mycolicibacterium alvei |
| 3 | 1724364 | 1724561 | - | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 4 | 76633 | 76830 | - | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 5 | 1467254 | 1467451 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 6 | 1569568 | 1569765 | - | NZ_LT906469.1 | Mycolicibacter terrae |
| 7 | 3968029 | 3968226 | + | NZ_AP022603.1 | Mycolicibacterium fallax |
| 8 | 1085130 | 1085327 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 9 | 146810 | 147013 | - | NZ_AP022566.1 | Mycolicibacterium alvei |
++ More..