Result : EXP01337
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01337 |
| NCBI Accession ID | NC_017381.1 |
| Organism | Helicobacter pylori 2018 |
| Left | 127923 |
| Right | 128060 |
| Strand | + |
| Nucleotide Sequence | GTGGTTTTGTATAGGCGGTTGTTATTGAATTTGTTTTGTATGGTATTTTTACAAGCGTGTTTAAAGCCTATGAGCGACCCTAAAGCTGAGAAAGTGGATTCGCAAGTGCAATGCGGGTTTGGCTCAAAAGATTGCTGA |
| Sequence | VVLYRRLLLNLFCMVFLQACLKPMSDPKAEKVDSQVQCGFGSKDC |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | P64654 |
| ORF Length (Amino Acid) | 45 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 125261 | 125398 | + | NC_017379.1 | Helicobacter pylori Puno135 |
| 2 | 1263631 | 1263771 | - | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 3 | 713029 | 713145 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 4 | 886000 | 886116 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017379.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01326.21 | 0.75 | 3 | 182 | opposite-strand | Pyruvate phosphate dikinase, AMP/ATP-binding domain |
| 2 | PF02896.20 | 0.75 | 3 | 182 | opposite-strand | PEP-utilising enzyme, PEP-binding domain |
| 3 | PF00391.25 | 0.75 | 3 | 182 | opposite-strand | PEP-utilising enzyme, mobile domain |
| 4 | PF00587.27 | 1.0 | 4 | 35.0 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
| 5 | PF03129.22 | 1.0 | 4 | 35.0 | same-strand | Anticodon binding domain |
| 6 | PF07973.16 | 1.0 | 4 | 35.0 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
| 7 | PF05198.18 | 1.0 | 4 | 1870.0 | same-strand | Translation initiation factor IF-3, N-terminal domain |
| 8 | PF00707.24 | 1.0 | 4 | 1870.0 | same-strand | Translation initiation factor IF-3, C-terminal domain |
| 9 | PF01632.21 | 1.0 | 4 | 2470.0 | same-strand | Ribosomal protein L35 |
| 10 | PF00453.20 | 1.0 | 4 | 2757.5 | same-strand | Ribosomal protein L20 |
| 11 | PF01856.19 | 0.75 | 3 | 3307 | same-strand | Helicobacter outer membrane protein |
++ More..