Result : EXP01335
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01335 |
| NCBI Accession ID | NC_017381.1 |
| Organism | Helicobacter pylori 2018 |
| Left | 1221020 |
| Right | 1221169 |
| Strand | - |
| Nucleotide Sequence | ATGAGTAAGCCTGAACATAAAATCAAAGCCACCCCCAAAGAGCTTTTAAGATCCAAGAATTTATCGCCTAAATACAGCCCAAACAATAGCCCCCAAACAATGCGGGTGTATTCAATGGGGGCAATGATCCCAGCAGGAGCGTTCATGTAA |
| Sequence | MSKPEHKIKATPKELLRSKNLSPKYSPNNSPQTMRVYSMGAMIPAGAFM |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1297060 | 1297209 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 2 | 1428683 | 1428832 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 3 | 705327 | 705455 | + | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017379.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12163.10 | 0.67 | 2 | 3318.5 | opposite-strand | DNA replication regulator |
| 2 | PF00809.24 | 0.67 | 2 | 1526.5 | opposite-strand | Pterin binding enzyme |
| 3 | PF00892.22 | 1.0 | 3 | -149 | opposite-strand | EamA-like transporter family |
| 4 | PF13536.8 | 0.67 | 2 | -149.0 | opposite-strand | Putative multidrug resistance efflux transporter |
| 5 | PF04368.15 | 1.0 | 3 | 1384 | opposite-strand | Protein of unknown function (DUF507) |
| 6 | PF00117.30 | 1.0 | 3 | 1935 | opposite-strand | Glutamine amidotransferase class-I |
| 7 | PF00988.24 | 1.0 | 3 | 1935 | opposite-strand | Carbamoyl-phosphate synthase small chain, CPSase domain |
++ More..