ProsmORF-pred
Result : EXP01332
Protein Information
Information Type Description
Protein name EXP01332
NCBI Accession ID BA000022.2
Organism Synechocystis sp. PCC 6803
Left 2210006
Right 2210194
Strand -
Nucleotide Sequence ATGCTGGGGAAAGAGAAGGATCCTGTGAGGGCAATGATTAGAACAAAACCGAAATCCGACAAGGTACTAACAATTCGCTTACCCGAAAAAGATTTGGTTCATTTGGAGCGTTACTGTGCGGCGGAAGGGCGGACTAAAACCGAAGTGTTGCGTCAGCTAATCCGAAATTTACCCACTGTTCCAGACTAG
Sequence MLGKEKDPVRAMIRTKPKSDKVLTIRLPEKDLVHLERYCAAEGRTKTEVLRQLIRNLPTVPD
Source of smORF Protein-level
Function The ORF matches to the profile of cl22901. Profile Description: Ribbon-helix-helix protein, copG family. ParD is the antitoxin of a bacterial toxin-antitoxin gene pair. The cognate toxin is ParE in, pfam05016. The family contains several related antitoxins from Cyanobacteria, Proteobacteria and Actinobacteria. Antitoxins of this class carry an N-terminal ribbon-helix-helix domain, RHH, that is highly conserved across all type II bacterial antitoxins, which dimerizes with the RHH domain of a second VapB molecule. A hinge section follows the RHH, with an additional pair of flexible alpha helices at the C-terminus. This C-terminus is the toxin-binding region of the dimer, and so is specific to the cognate toxin, whereas the RHH domain has the specific function of lying across the RNA-binding groove of the toxin dimer and inactivating the active-site - a more general function of all type II antitoxins.
Pubmed ID 30796087
Domain CDD:419885
Functional Category Conserved domain based functional assignment
Uniprot ID
ORF Length (Amino Acid) 62
++ More..