Result : EXP01331

Protein Information

• Protein name: EXP01331
• NCBI Accession ID: NC_017381.1
• Organism: Helicobacter pylori 2018
• Left: 1141503
• Right: 1141616
• Strand: -
• Nucleotide Sequence: GTGATGCCTTTAATGAAAGTTAAGGGATCGTTAATATTAGAACTCAAATGCTTTTTTAAAAGCGTTTTGATTTCCAAATCATTCACAGGACTCCTTTTTATCGCGCTCAAATAA
• Sequence: VMPLMKVKGSLILELKCFFKSVLISKSFTGLLFIALK
• Source of smORF: Protein-level
• Pubmed ID: 30796087
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 37

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1212533	1212646	-	NC_017379.1	Helicobacter pylori Puno135
2	1148168	1148281	-	NC_008229.1	Helicobacter acinonychis str. Sheeba
3	203019	203132	-	NC_017735.1	Helicobacter cetorum MIT 99-5656

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_017379.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF04101.18	0.67	2	7107.5	opposite-strand	Glycosyltransferase family 28 C-terminal domain
2	PF03033.22	0.67	2	7107.5	opposite-strand	Glycosyltransferase family 28 N-terminal domain
3	PF01856.19	1.0	3	4911	opposite-strand	Helicobacter outer membrane protein
4	PF14748.8	0.67	2	410.5	opposite-strand	Pyrroline-5-carboxylate reductase dimerisation
5	PF03807.19	0.67	2	410.5	opposite-strand	NADP oxidoreductase coenzyme F420-dependent
6	PF02661.20	0.67	2	-113.0	opposite-strand	Fic/DOC family
7	PF00258.27	0.67	2	1233.5	same-strand	Flavodoxin
8	PF09335.13	0.67	2	1824.0	same-strand	SNARE associated Golgi protein