Result : EXP01324
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01324 |
| NCBI Accession ID | NC_017381.1 |
| Organism | Helicobacter pylori 2018 |
| Left | 323879 |
| Right | 324085 |
| Strand | - |
| Nucleotide Sequence | TTGCGTAACACCCAACAACTTACAAGTATCATCGCCACTCATGATCCTATTGTCTTAGATAGTTGCGAATGGGTATTGCTCCTTAAGAATGGCAACATTGCTCAATACAAACCTTTAAATTCTATATTAAAATCTGTAGCTAAAACTTTTAACTTTAAAGAAAAACCAACCACAAAAGACTTATTAGCATTACTAAAGGATATTTAG |
| Sequence | LRNTQQLTSIIATHDPIVLDSCEWVLLLKNGNIAQYKPLNSILKSVAKTFNFKEKPTTKDLLALLKDI |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1196381 | 1196587 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 2 | 611383 | 611589 | - | NC_017379.1 | Helicobacter pylori Puno135 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008229.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01061.26 | 1.0 | 2 | 0.0 | same-strand | ABC-2 type transporter |
| 2 | PF03077.16 | 1.0 | 2 | 806.5 | opposite-strand | Putative vacuolating cytotoxin |
| 3 | PF00873.21 | 1.0 | 2 | 11101.5 | opposite-strand | AcrB/AcrD/AcrF family |
++ More..