Result : EXP01321

Protein Information

• Protein name: EXP01321
• NCBI Accession ID: NC_017381.1
• Organism: Helicobacter pylori 2018
• Left: 405607
• Right: 405720
• Strand: +
• Nucleotide Sequence: ATGTTTTTGTTTTGCAAGCGGTGTTCTTGGATTTTATCTTGCAAATACTCTGCTTTGTTTAAGTTCAAATTCAAATCGCTAACCAAAATAAGGAATTCACTCTCTTTAGATTGA
• Sequence: MFLFCKRCSWILSCKYSALFKFKFKSLTKIRNSLSLD
• Source of smORF: Protein-level
• Pubmed ID: 30796087
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 37

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	408335	408448	+	NC_017379.1	Helicobacter pylori Puno135
2	996106	996219	-	NC_008229.1	Helicobacter acinonychis str. Sheeba

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_017379.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00149.30	1.0	2	3267.5	same-strand	Calcineurin-like phosphoesterase
2	PF00486.30	1.0	2	2241.0	same-strand	Transcriptional regulatory protein, C terminal
3	PF00072.26	1.0	2	2241.0	same-strand	Response regulator receiver domain
4	PF00771.22	1.0	2	174.5	opposite-strand	FHIPEP family
5	PF00312.24	1.0	2	2524.0	same-strand	Ribosomal protein S15
6	PF04932.17	1.0	2	2841.0	same-strand	O-Antigen ligase
7	PF01220.21	1.0	2	4254.5	same-strand	Dehydroquinase class II