Result : EXP01319
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01319 |
| NCBI Accession ID | NZ_CP001668.1 |
| Organism | Mycoplasma mycoides subsp. capri LC str. 95010 |
| Left | 381847 |
| Right | 381978 |
| Strand | - |
| Nucleotide Sequence | GTGAAGCTGGAGGAATTACTCAAGCGATTGGTGCTTATCAAATTACTACAAAACATAATAAAAAAATTACATTTATTGATACTCCAGGTCATGAGGCATTTACTGAAATGAGAAGTAGGGGTGCTAATGTAA |
| Sequence | VKLEELLKRLVLIKLLQNIIKKLHLLILQVMRHLLKWEVGVLM |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 43 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 247727 | 247843 | + | NZ_CP007520.1 | Mycoplasma yeatsii GM274B |
| 2 | 328676 | 328795 | + | NC_010163.1 | Acholeplasma laidlawii PG-8A |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP007520.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04296.15 | 1.0 | 2 | 753.5 | same-strand | Protein of unknown function (DUF448) |
| 2 | PF01248.28 | 1.0 | 2 | 473.0 | same-strand | Ribosomal protein L7Ae/L30e/S12e/Gadd45 family |
| 3 | PF00009.29 | 1.0 | 2 | -117.5 | same-strand | Elongation factor Tu GTP binding domain |
| 4 | PF11987.10 | 1.0 | 2 | -117.5 | same-strand | Translation-initiation factor 2 |
| 5 | PF01926.25 | 1.0 | 2 | -117.5 | same-strand | 50S ribosome-binding GTPase |
| 6 | PF04760.17 | 1.0 | 2 | -117.5 | same-strand | Translation initiation factor IF-2, N-terminal region |
| 7 | PF00071.24 | 1.0 | 2 | -117.5 | same-strand | Ras family |
++ More..