Result : EXP01311

Protein Information

• Protein name: EXP01311
• NCBI Accession ID: NZ_CP009472.1
• Organism: Lactococcus lactis strain AI06
• Left: 1641149
• Right: 1641331
• Strand: -
• Nucleotide Sequence: ATGACAACACAAGAACTTATTGAAACCTTACAAAAATTTCCGGCAGAAGCAACTGTAAAAATTATTCAAAACGATATCAGTGGTGACCGATTTTTTGATGTTAATACAGTAGAAAATCTGGCCAGAGTCCGTGTTACCACTGCAGGAGTTGAAACCGTAGATACCGTGATTATTGGTATTTAA
• Sequence: MTTQELIETLQKFPAEATVKIIQNDISGDRFFDVNTVENLARVRVTTAGVETVDTVIIGI
• Source of smORF: Protein-level
• Pubmed ID: 30796087
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 60

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1594432	1594614	-	NC_022369.1	Lactococcus lactis subsp. cremoris KW2
2	437324	437506	+	NZ_CP032627.1	Lactococcus allomyrinae

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_022369.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF08951.12	1.0	2	2095.0	same-strand	Enterocin A Immunity
2	PF01625.23	1.0	2	524.0	opposite-strand	Peptide methionine sulfoxide reductase
3	PF00005.29	1.0	2	2.0	same-strand	ABC transporter
4	PF16326.7	1.0	2	2.0	same-strand	ABC transporter C-terminal domain
5	PF12848.9	1.0	2	2.0	same-strand	ABC transporter
6	PF00465.21	1.0	2	4061.0	same-strand	Iron-containing alcohol dehydrogenase
7	PF13685.8	1.0	2	4061.0	same-strand	Iron-containing alcohol dehydrogenase