Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01310 |
NCBI Accession ID | NC_017381.1 |
Organism | Helicobacter pylori 2018 |
Left | 941388 |
Right | 941531 |
Strand | - |
Nucleotide Sequence | ATGGGGGCGCTTCCTTTGTCATCCAACAAGCACCAAGAAAAAGCTTTAGAGCTTATCAATCAAGCGATGCAAAGATTGATCAATAAAGGGGTTTTAAAACGCTTAGGCGAACAATTTTTTGGAAAAGATGTCAGCCAGCCCTAA |
Sequence | MGALPLSSNKHQEKALELINQAMQRLINKGVLKRLGEQFFGKDVSQP |
Source of smORF | Protein-level |
Function | |
Pubmed ID | 30796087 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 47 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 834802 | 834930 | + | NZ_CP019448.1 | Simonsiella muelleri ATCC 29453 |
2 | 854825 | 854950 | + | NZ_CP015425.1 | [Haemophilus] ducreyi |
3 | 1718718 | 1718846 | - | NZ_CP059569.1 | Kingella oralis |
4 | 2322807 | 2322947 | + | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
5 | 151553 | 151693 | - | NZ_CP061280.1 | Mannheimia bovis |
6 | 1180441 | 1180569 | + | NZ_CP059564.1 | Alysiella filiformis |
7 | 603242 | 603382 | + | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
8 | 2051277 | 2051402 | - | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
9 | 2069141 | 2069266 | + | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00528.24 | 0.67 | 6 | 119.0 | same-strand | Binding-protein-dependent transport system inner membrane component |
2 | PF00005.29 | 0.67 | 6 | 895.0 | same-strand | ABC transporter |