Result : EXP01310
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01310 |
| NCBI Accession ID | NC_017381.1 |
| Organism | Helicobacter pylori 2018 |
| Left | 941388 |
| Right | 941531 |
| Strand | - |
| Nucleotide Sequence | ATGGGGGCGCTTCCTTTGTCATCCAACAAGCACCAAGAAAAAGCTTTAGAGCTTATCAATCAAGCGATGCAAAGATTGATCAATAAAGGGGTTTTAAAACGCTTAGGCGAACAATTTTTTGGAAAAGATGTCAGCCAGCCCTAA |
| Sequence | MGALPLSSNKHQEKALELINQAMQRLINKGVLKRLGEQFFGKDVSQP |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 834802 | 834930 | + | NZ_CP019448.1 | Simonsiella muelleri ATCC 29453 |
| 2 | 854825 | 854950 | + | NZ_CP015425.1 | [Haemophilus] ducreyi |
| 3 | 1718718 | 1718846 | - | NZ_CP059569.1 | Kingella oralis |
| 4 | 2322807 | 2322947 | + | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 5 | 151553 | 151693 | - | NZ_CP061280.1 | Mannheimia bovis |
| 6 | 1180441 | 1180569 | + | NZ_CP059564.1 | Alysiella filiformis |
| 7 | 603242 | 603382 | + | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 8 | 2051277 | 2051402 | - | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 9 | 2069141 | 2069266 | + | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP015425.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00528.24 | 0.67 | 6 | 119.0 | same-strand | Binding-protein-dependent transport system inner membrane component |
| 2 | PF00005.29 | 0.67 | 6 | 895.0 | same-strand | ABC transporter |
++ More..