Result : B2S3P6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Translational regulator CsrA |
| NCBI Accession ID | CP000805.1 |
| Organism | Treponema pallidum subsp. pallidum (strain SS14) |
| Left | 721149 |
| Right | 721370 |
| Strand | - |
| Nucleotide Sequence | ATGTTGATCCTTTCGCGCAAGACAAATCAGAAAATCTTTATTGGGGACTCGATTGAACTGACTATTATTGAGATTCGCGGCGATCAGGTAAAAGTCGGTGTGGAAGCGCCGCGTTCGGTGAAAATATTCCGACAAGAGGTATACGAAGAGATCCAGAGAGAGAACCGCGCTGCGTCCGACTCCCCCTGGTCTCCTAACTCATTGCCTCAGTTGCCTGTGTAG |
| Sequence | MLILSRKTNQKIFIGDSIELTIIEIRGDQVKVGVEAPRSVKIFRQEVYEEIQRENRAASDSPWSPNSLPQLPV |
| Source of smORF | Swiss-Prot |
| Function | A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'-UTR at or near the Shine-Dalgarno sequence preventing ribosome-binding, thus repressing translation. Its main target seems to be the major flagellin gene, while its function is anatagonized by FliW. {ECO:0000255|HAMAP-Rule:MF_00167}. |
| Pubmed ID | 18482458 |
| Domain | CDD:412510 |
| Functional Category | RNA-binding |
| Uniprot ID | B2S3P6 |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 81
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 714565 | 714786 | - | NC_015714.1 | Treponema paraluiscuniculi Cuniculi A |
| 2 | 21548 | 21778 | + | NZ_CP009228.1 | Treponema putidum |
| 3 | 2296981 | 2297211 | + | NC_022097.1 | Treponema pedis str. T A4 |
| 4 | 1265233 | 1265469 | + | NC_015732.1 | Treponema caldarium DSM 7334 |
| 5 | 2784134 | 2784385 | - | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 6 | 1309609 | 1309839 | + | NC_023035.1 | Salinispira pacifica |
| 7 | 1540467 | 1540691 | - | NC_018020.1 | Turneriella parva DSM 21527 |
| 8 | 2184910 | 2185131 | - | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 9 | 926283 | 926525 | + | NC_017098.1 | Spirochaeta africana DSM 8902 |
| 10 | 1498786 | 1499004 | - | NC_015385.1 | Treponema succinifaciens DSM 2489 |
| 11 | 3625458 | 3625712 | - | NZ_CP026671.1 | Leptospira borgpetersenii serovar Ceylonica |
| 12 | 903031 | 903258 | + | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 13 | 4850605 | 4850835 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 14 | 1083494 | 1083733 | + | NZ_CP026363.1 | Brevibacillus agri |
| 15 | 585907 | 586149 | + | NZ_CP012502.1 | Bacillus beveridgei |
| 16 | 387891 | 388109 | + | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 17 | 114616 | 114834 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 18 | 1957888 | 1958118 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 19 | 4809365 | 4809553 | - | NZ_CP042914.1 | Roseimaritima ulvae |
| 20 | 4813240 | 4813437 | + | NZ_CP017641.1 | Fuerstia marisgermanicae |
| 21 | 3756078 | 3756272 | - | NZ_CP017641.1 | Fuerstia marisgermanicae |
| 22 | 281384 | 281605 | + | NZ_CP025197.1 | Acetivibrio saccincola |
| 23 | 3369879 | 3370103 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 24 | 4689439 | 4689657 | - | NZ_CP036278.1 | Aeoliella mucimassa |
| 25 | 4010504 | 4010752 | - | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 26 | 3195566 | 3195790 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 27 | 2979345 | 2979569 | - | NC_005027.1 | Rhodopirellula baltica SH 1 |
| 28 | 691099 | 691338 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 29 | 1581359 | 1581589 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 30 | 2987338 | 2987550 | - | NZ_CP043930.1 | Gimesia benthica |
| 31 | 7558170 | 7558367 | - | NZ_CP043930.1 | Gimesia benthica |
| 32 | 4381401 | 4381604 | - | NZ_CP036281.1 | Polystyrenella longa |
| 33 | 5174989 | 5175189 | + | NZ_CP036281.1 | Polystyrenella longa |
| 34 | 164863 | 165084 | + | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 35 | 162405 | 162626 | + | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 36 | 2140105 | 2140323 | + | NC_019892.1 | Singulisphaera acidiphila DSM 18658 |
| 37 | 2163811 | 2164035 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 38 | 2103090 | 2103314 | + | NZ_CP043404.1 | Bacillus safensis |
| 39 | 3720287 | 3720514 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 40 | 1759203 | 1759412 | - | NZ_CP042997.1 | Aquisphaera giovannonii |
| 41 | 4329130 | 4329351 | - | NZ_CP036292.1 | Rosistilla oblonga |
| 42 | 2419788 | 2420015 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 43 | 2390978 | 2391205 | + | NC_002967.9 | Treponema denticola ATCC 35405 |
| 44 | 2636505 | 2636720 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 45 | 1575912 | 1576139 | - | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 46 | 786473 | 786706 | + | NZ_CP036353.1 | Gimesia maris |
| 47 | 3225279 | 3225482 | - | NZ_CP019082.1 | Paludisphaera borealis |
| 48 | 1017009 | 1017251 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 49 | 4028009 | 4028233 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 50 | 7555254 | 7555466 | - | NZ_CP036275.1 | Maioricimonas rarisocia |
| 51 | 7504516 | 7504716 | - | NZ_CP036275.1 | Maioricimonas rarisocia |
| 52 | 6086774 | 6086992 | + | NZ_CP036275.1 | Maioricimonas rarisocia |
| 53 | 5013312 | 5013557 | - | NC_014962.1 | Isosphaera pallida ATCC 43644 |
| 54 | 2813935 | 2814135 | - | NC_015174.1 | Rubinisphaera brasiliensis DSM 5305 |
| 55 | 4280243 | 4280476 | + | NZ_CP036291.1 | Pirellulimonas nuda |
| 56 | 2612721 | 2612945 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 57 | 4698768 | 4698983 | - | NZ_CP042912.1 | Mariniblastus fucicola |
| 58 | 3154882 | 3155130 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 59 | 3881618 | 3881845 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 60 | 5630853 | 5631077 | + | NZ_CP036289.1 | Bremerella volcania |
| 61 | 3602238 | 3602462 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 62 | 929606 | 929827 | + | NZ_CP031518.1 | Treponema ruminis |
| 63 | 619047 | 619265 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 64 | 777447 | 777674 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 65 | 3796801 | 3797025 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 66 | 4127505 | 4127744 | + | NZ_CP018477.1 | Thermogutta terrifontis |
| 67 | 689278 | 689496 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 68 | 2814492 | 2814719 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 69 | 2501497 | 2501718 | + | NZ_CP035485.1 | Salicibibacter halophilus |
| 70 | 268313 | 268537 | + | NZ_CP009687.1 | Clostridium aceticum |
| 71 | 2589824 | 2590054 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 72 | 2811116 | 2811340 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 73 | 3487544 | 3487771 | - | NZ_LS483476.1 | Lederbergia lentus |
| 74 | 2478099 | 2478317 | + | NZ_AP021861.1 | Lacipirellula parvula |
| 75 | 1704134 | 1704355 | - | NZ_AP021861.1 | Lacipirellula parvula |
| 76 | 675586 | 675813 | + | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 77 | 3418172 | 3418396 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 78 | 2620097 | 2620321 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 79 | 3492638 | 3492862 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 80 | 2693365 | 2693589 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 81 | 3498534 | 3498758 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 82 | 2142768 | 2143001 | - | NC_015577.1 | Treponema azotonutricium ZAS-9 |
| 83 | 1463021 | 1463248 | + | NZ_AP019551.1 | Athalassotoga saccharophila |
| 84 | 3076541 | 3076765 | + | NZ_CP035807.1 | Thiospirochaeta perfilievii |
| 85 | 545108 | 545332 | + | NZ_CP011937.1 | Bacillus velezensis |
| 86 | 3499317 | 3499541 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 87 | 1473064 | 1473285 | + | NZ_CP034248.1 | Paenibacillus lentus |
| 88 | 262435 | 262656 | + | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP009228.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02623.17 | 0.83 | 67 | 0.5 | same-strand | FliW protein |
| 2 | PF00669.22 | 0.81 | 66 | 772 | same-strand | Bacterial flagellin N-terminal helical region |
| 3 | PF05130.14 | 0.65 | 53 | 3595 | same-strand | FlgN protein |
| 4 | PF00700.23 | 0.7 | 57 | 1050 | same-strand | Bacterial flagellin C-terminal helical region |
++ More..