Protein name |
EXP01303 |
NCBI Accession ID |
NC_017381.1 |
Organism |
Helicobacter pylori 2018 |
Left |
1561845 |
Right |
1562036 |
Strand |
- |
Nucleotide Sequence |
ATGGCATACAAATATGATAGAGATTTGGAATTTTTAAAGCAATTGGAATCTAGTGATTTATTGGATTTGTTTGAGGTGCTTGTTTTTGGTAAAGACGGCGAAAAAAGACACAATGAAAAACTGACAAGCTCCCTAGAATACAAAAGGCATGGCGATGATTACGCTAAATACGCAGAAAGGATCGCTGAATAG |
Sequence |
MAYKYDRDLEFLKQLESSDLLDLFEVLVFGKDGEKRHNEKLTSSLEYKRHGDDYAKYAERIAE |
Source of smORF |
Protein-level |
Function |
The ORF matches to the profile of pfam13099. Profile Description: Domain of unknown function (DUF3944). This short domain is sometimes found N terminal to pfam03981. |
Pubmed ID |
30796087
|
Domain |
CDD:289844 |
Functional Category |
Conserved domain based functional assignment |
Uniprot ID |
|
ORF Length (Amino Acid) |
63 |