| Protein name |
EXP01303 |
| NCBI Accession ID |
NC_017381.1 |
| Organism |
Helicobacter pylori 2018 |
| Left |
1561845 |
| Right |
1562036 |
| Strand |
- |
| Nucleotide Sequence |
ATGGCATACAAATATGATAGAGATTTGGAATTTTTAAAGCAATTGGAATCTAGTGATTTATTGGATTTGTTTGAGGTGCTTGTTTTTGGTAAAGACGGCGAAAAAAGACACAATGAAAAACTGACAAGCTCCCTAGAATACAAAAGGCATGGCGATGATTACGCTAAATACGCAGAAAGGATCGCTGAATAG |
| Sequence |
MAYKYDRDLEFLKQLESSDLLDLFEVLVFGKDGEKRHNEKLTSSLEYKRHGDDYAKYAERIAE |
| Source of smORF |
Protein-level |
| Function |
The ORF matches to the profile of pfam13099. Profile Description: Domain of unknown function (DUF3944). This short domain is sometimes found N terminal to pfam03981. |
| Pubmed ID |
30796087
|
| Domain |
CDD:289844 |
| Functional Category |
Conserved domain based functional assignment |
| Uniprot ID |
|
| ORF Length (Amino Acid) |
63 |