Result : EXP01302
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01302 |
| NCBI Accession ID | NC_017548.1 |
| Organism | Pseudomonas aeruginosa M18 |
| Left | 604656 |
| Right | 604856 |
| Strand | + |
| Nucleotide Sequence | ATGCGTTCCGTAACCTTGCCACTCCTGATGTTCTGCCTGGGCCTGGCCGCCTGTAGCGGCGATGGCGGTCGACGCCCGAGCACCTGCGAGGTGATCAGTCCGCCGGACGTGATGGTGCCGACCGAGCAGAACCGCCAGCGGGTCGAGCAGCAGAGCAGCGGCGATCCGACCGCCGGACAAAAGCCGGTGGAATGCCCGTAG |
| Sequence | MRSVTLPLLMFCLGLAACSGDGGRRPSTCEVISPPDVMVPTEQNRQRVEQQSSGDPTAGQKPVECP |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 66 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 612517 | 612717 | + | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 2 | 1187861 | 1188055 | + | NZ_CP048833.1 | Pseudomonas multiresinivorans |
| 3 | 379562 | 379756 | + | NZ_CP043311.1 | Pseudomonas lalkuanensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002516.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00456.23 | 1.0 | 3 | 2420 | same-strand | Transketolase, thiamine diphosphate binding domain |
| 2 | PF02779.26 | 1.0 | 3 | 2420 | same-strand | Transketolase, pyrimidine binding domain |
| 3 | PF02780.22 | 1.0 | 3 | 2420 | same-strand | Transketolase, C-terminal domain |
| 4 | PF02775.23 | 0.67 | 2 | 3390.0 | same-strand | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain |
| 5 | PF02800.22 | 1.0 | 3 | 1256 | same-strand | Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain |
| 6 | PF00044.26 | 1.0 | 3 | 1256 | same-strand | Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain |
| 7 | PF00162.21 | 1.0 | 3 | 73 | same-strand | Phosphoglycerate kinase |
| 8 | PF09864.11 | 1.0 | 3 | 143 | same-strand | Membrane-bound lysozyme-inhibitor of c-type lysozyme |
| 9 | PF01116.22 | 1.0 | 3 | 599 | same-strand | Fructose-bisphosphate aldolase class-II |
| 10 | PF08241.14 | 0.67 | 2 | 2890 | same-strand | Methyltransferase domain |
| 11 | PF13649.8 | 0.67 | 2 | 2890 | same-strand | Methyltransferase domain |
| 12 | PF08242.14 | 0.67 | 2 | 2890 | same-strand | Methyltransferase domain |
++ More..