Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01302 |
NCBI Accession ID | NC_017548.1 |
Organism | Pseudomonas aeruginosa M18 |
Left | 604656 |
Right | 604856 |
Strand | + |
Nucleotide Sequence | ATGCGTTCCGTAACCTTGCCACTCCTGATGTTCTGCCTGGGCCTGGCCGCCTGTAGCGGCGATGGCGGTCGACGCCCGAGCACCTGCGAGGTGATCAGTCCGCCGGACGTGATGGTGCCGACCGAGCAGAACCGCCAGCGGGTCGAGCAGCAGAGCAGCGGCGATCCGACCGCCGGACAAAAGCCGGTGGAATGCCCGTAG |
Sequence | MRSVTLPLLMFCLGLAACSGDGGRRPSTCEVISPPDVMVPTEQNRQRVEQQSSGDPTAGQKPVECP |
Source of smORF | Protein-level |
Function | |
Pubmed ID | 30796087 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 66 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 612517 | 612717 | + | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
2 | 1187861 | 1188055 | + | NZ_CP048833.1 | Pseudomonas multiresinivorans |
3 | 379562 | 379756 | + | NZ_CP043311.1 | Pseudomonas lalkuanensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00456.23 | 1.0 | 3 | 2420 | same-strand | Transketolase, thiamine diphosphate binding domain |
2 | PF02779.26 | 1.0 | 3 | 2420 | same-strand | Transketolase, pyrimidine binding domain |
3 | PF02780.22 | 1.0 | 3 | 2420 | same-strand | Transketolase, C-terminal domain |
4 | PF02775.23 | 0.67 | 2 | 3390.0 | same-strand | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain |
5 | PF02800.22 | 1.0 | 3 | 1256 | same-strand | Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain |
6 | PF00044.26 | 1.0 | 3 | 1256 | same-strand | Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain |
7 | PF00162.21 | 1.0 | 3 | 73 | same-strand | Phosphoglycerate kinase |
8 | PF09864.11 | 1.0 | 3 | 143 | same-strand | Membrane-bound lysozyme-inhibitor of c-type lysozyme |
9 | PF01116.22 | 1.0 | 3 | 599 | same-strand | Fructose-bisphosphate aldolase class-II |
10 | PF08241.14 | 0.67 | 2 | 2890 | same-strand | Methyltransferase domain |
11 | PF13649.8 | 0.67 | 2 | 2890 | same-strand | Methyltransferase domain |
12 | PF08242.14 | 0.67 | 2 | 2890 | same-strand | Methyltransferase domain |