| Protein name |
EXP01300 |
| NCBI Accession ID |
NC_017548.1 |
| Organism |
Pseudomonas aeruginosa M18 |
| Left |
5891309 |
| Right |
5891524 |
| Strand |
- |
| Nucleotide Sequence |
ATGGGTTTCCTGATACTCTCCCGCCGAGAAGGCGAAGGCATCACCCTGTCCCTCAAGGCCGACTACCCGGCGGAGGAACTGATTCGGCAATTGCGCGAAGGCGGCATCCGGATCCTGGTCACCGATATCATCGGCAACCAGGCCCGGGTCGGGATCGAGGCGCCGCGTGGCGTCCTGATCGTTCGCGACGAGTTGAAAACGGCACCGAAAGGCTGA |
| Sequence |
MGFLILSRREGEGITLSLKADYPAEELIRQLREGGIRILVTDIIGNQARVGIEAPRGVLIVRDELKTAPKG |
| Source of smORF |
Protein-level |
| Function |
The ORF matches to the profile of cl00670. Profile Description: Global regulator protein family. Modulates the expression of genes in the glycogen biosynthesis and gluconeogenesis pathways by accelerating the 5'-to-3' degradation of these transcripts through selective RNA binding. The N-terminal end of the sequence (AA 11-45) contains the KH motif which is characteristic of a set of RNA-binding proteins. [Energy metabolism, Glycolysis/gluconeogenesis, Regulatory functions, RNA interactions] |
| Pubmed ID |
30796087
|
| Domain |
CDD:412510 |
| Functional Category |
Conserved domain based functional assignment |
| Uniprot ID |
|
| ORF Length (Amino Acid) |
71 |