| Protein name |
EXP01299 |
| NCBI Accession ID |
BA000022.2 |
| Organism |
Synechocystis sp. PCC 6803 |
| Left |
2774448 |
| Right |
2774726 |
| Strand |
+ |
| Nucleotide Sequence |
TTGATATCGCTAATATTAATAGTCCTGAAGATTATGGCCAAATCAATTAAACTCAGATATTTTGCTTCTCTCCAAGAACAGGCTAAGGTTGCAGAAGAAAGTTTAGTAACAAAGCTAAATACCTACCAAGAACTTTATGATTCCTTGGCTAAACGTCATGGTTTTAATTTATCCTCCTCCCAAGTCAAAGTGGCAGTTAATGATGAATTTACCACCATGGAAAATATAATTTTAGACCAGTCCACAATTGTTTTTATCCCCCCCGTTGCTGGGGGTTAA |
| Sequence |
LISLILIVLKIMAKSIKLRYFASLQEQAKVAEESLVTKLNTYQELYDSLAKRHGFNLSSSQVKVAVNDEFTTMENIILDQSTIVFIPPVAGG |
| Source of smORF |
Protein-level |
| Function |
The ORF matches to the profile of cl28922. Profile Description: Beta-grasp ubiquitin-like fold. This domain is the binding/interacting region of several protein kinases, such as the Schizosaccharomyces pombe Byr2. Byr2 is a Ser/Thr-specific protein kinase acting as mediator of signals for sexual differentiation in S. pombe by initiating a MAPK module, which is a highly conserved element in eukaryotes. Byr2 is activated by interacting with Ras, which then translocates the molecule to the plasma membrane. Ras proteins are key elements in intracellular signaling and are involved in a variety of vital processes such as DNA transcription, growth control, and differentiation. They function like molecular switches cycling between GTP-bound 'on' and GDP-bound 'off' states. |
| Pubmed ID |
30796087
|
| Domain |
CDD:421700 |
| Functional Category |
Conserved domain based functional assignment |
| Uniprot ID |
|
| ORF Length (Amino Acid) |
92 |