Result : EXP01298
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01298 |
| NCBI Accession ID | NZ_CP009472.1 |
| Organism | Lactococcus lactis strain AI06 |
| Left | 1027574 |
| Right | 1027744 |
| Strand | + |
| Nucleotide Sequence | ATGAATCGTACATTTATTAAAGGCTTTTTGACAGGGAATGCACTTTTGATAGCTGGACTTGCTGCCACTGCTATTGGCATTAAAGCAAAAGTTATCAATCCTATCAAGAAAAAAGAAGAACAAATTGAATTGGGTAGAAAACGAGCAGCCAGAAAACGGATTGCCCCCTAA |
| Sequence | MNRTFIKGFLTGNALLIAGLAATAIGIKAKVINPIKKKEEQIELGRKRAARKRIAP |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of pfam11240. Profile Description: Protein of unknown function (DUF3042). This family of proteins with unknown function appears to be restricted to Firmicutes. |
| Pubmed ID | 30796087 |
| Domain | CDD:402706 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 56 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1467405 | 1467575 | - | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 2 | 88068 | 88241 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
| 3 | 717712 | 717885 | - | NZ_CP070872.1 | Lactococcus taiwanensis |
| 4 | 1369322 | 1369489 | - | NZ_CP060720.1 | Vagococcus carniphilus |
| 5 | 2881892 | 2882059 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 6 | 1314518 | 1314688 | + | NZ_AP018400.1 | Streptococcus ruminantium |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP032627.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01715.19 | 0.83 | 5 | 867 | opposite-strand | IPP transferase |
++ More..