Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01298 |
NCBI Accession ID | NZ_CP009472.1 |
Organism | Lactococcus lactis strain AI06 |
Left | 1027574 |
Right | 1027744 |
Strand | + |
Nucleotide Sequence | ATGAATCGTACATTTATTAAAGGCTTTTTGACAGGGAATGCACTTTTGATAGCTGGACTTGCTGCCACTGCTATTGGCATTAAAGCAAAAGTTATCAATCCTATCAAGAAAAAAGAAGAACAAATTGAATTGGGTAGAAAACGAGCAGCCAGAAAACGGATTGCCCCCTAA |
Sequence | MNRTFIKGFLTGNALLIAGLAATAIGIKAKVINPIKKKEEQIELGRKRAARKRIAP |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of pfam11240. Profile Description: Protein of unknown function (DUF3042). This family of proteins with unknown function appears to be restricted to Firmicutes. |
Pubmed ID | 30796087 |
Domain | CDD:402706 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 56 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1467405 | 1467575 | - | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
2 | 88068 | 88241 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
3 | 717712 | 717885 | - | NZ_CP070872.1 | Lactococcus taiwanensis |
4 | 1369322 | 1369489 | - | NZ_CP060720.1 | Vagococcus carniphilus |
5 | 2881892 | 2882059 | + | NZ_CP049887.1 | Vagococcus hydrophili |
6 | 1314518 | 1314688 | + | NZ_AP018400.1 | Streptococcus ruminantium |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01715.19 | 0.83 | 5 | 867 | opposite-strand | IPP transferase |