Result : EXP01295
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01295 |
| NCBI Accession ID | NC_017340.1 |
| Organism | Staphylococcus aureus 04-02981 |
| Left | 2330256 |
| Right | 2330420 |
| Strand | + |
| Nucleotide Sequence | ATGTCTTTAGAAAACCAACTAGCCGAACTTAAATATGATTATGTTCGTCTTCAAGGTGACTTAGAAAAACGGGAATCTTTGAATTTAGATACTTCCGCACTTGTTCGTCAACTTAAAGATATTGAAAATGAAATTAGAAACGTTCGCGCTCAAATGCAAGATTAA |
| Sequence | MSLENQLAELKYDYVRLQGDLEKRESLNLDTSALVRQLKDIENEIRNVRAQMQD |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 54 |
++ More..
| Conservation Analysis |
No. of Species: 27
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2326237 | 2326401 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 2282145 | 2282309 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 2181201 | 2181374 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 778953 | 779129 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 5 | 1990246 | 1990422 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 6 | 771891 | 772058 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 7 | 1067679 | 1067849 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 8 | 1498868 | 1499035 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 9 | 712496 | 712672 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 10 | 699112 | 699279 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 11 | 2677425 | 2677598 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 12 | 219327 | 219494 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 13 | 1794405 | 1794572 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 14 | 776539 | 776703 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 15 | 1448435 | 1448599 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 16 | 1737407 | 1737571 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 17 | 2224798 | 2224965 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 18 | 1271710 | 1271877 | - | NZ_CP027770.1 | Staphylococcus felis |
| 19 | 746690 | 746860 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 20 | 759142 | 759318 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 21 | 2211617 | 2211787 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 22 | 1680670 | 1680837 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 23 | 465030 | 465197 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 24 | 547948 | 548115 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 25 | 602355 | 602531 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 26 | 660484 | 660660 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 27 | 104743 | 104898 | - | NZ_CP019573.1 | Abyssicoccus albus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP008724.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01131.22 | 0.81 | 22 | 3975.5 | opposite-strand | DNA topoisomerase |
| 2 | PF01751.24 | 0.81 | 22 | 3975.5 | opposite-strand | Toprim domain |
| 3 | PF00583.27 | 0.63 | 17 | 2973 | same-strand | Acetyltransferase (GNAT) family |
| 4 | PF06800.14 | 0.7 | 19 | 2064 | same-strand | Sugar transport protein |
| 5 | PF02355.18 | 0.89 | 24 | 659.5 | opposite-strand | Protein export membrane protein |
| 6 | PF02388.18 | 0.96 | 26 | 3975.0 | opposite-strand | FemAB family |
| 7 | PF13468.8 | 0.74 | 20 | 5601.0 | opposite-strand | Glyoxalase-like domain |
| 8 | PF13561.8 | 0.63 | 17 | 1228 | same-strand | Enoyl-(Acyl carrier protein) reductase |
| 9 | PF00106.27 | 0.63 | 17 | 1228 | same-strand | short chain dehydrogenase |
++ More..