Result : EXP01287
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01287 |
| NCBI Accession ID | NC_017340.1 |
| Organism | Staphylococcus aureus 04-02981 |
| Left | 2025504 |
| Right | 2025677 |
| Strand | - |
| Nucleotide Sequence | ATGTGGAATTTTATTAAATGTGTGTTTAAATTCGTATTTAGCTTAGTTGCTATTACAACATTAGTTGCTGGTGTTGGTGTAGTAGCATTTGCTTATATCTTTAAAAAAGATTTTGAAGATATTGAAAGAAAAACTAAAGAAATTATTTCTGATATTGAAAGTAAAAATAACTAA |
| Sequence | MWNFIKCVFKFVFSLVAITTLVAGVGVVAFAYIFKKDFEDIERKTKEIISDIESKNN |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 57 |
++ More..
| Conservation Analysis |
No. of Species: 29
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2019521 | 2019694 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 2 | 2018697 | 2018870 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 3 | 2473414 | 2473587 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 4 | 927890 | 928060 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 5 | 926304 | 926474 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 6 | 504114 | 504284 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 7 | 983188 | 983358 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 8 | 139015 | 139185 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 9 | 1231571 | 1231741 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 10 | 1006458 | 1006628 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 11 | 1937959 | 1938132 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 12 | 797857 | 798027 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 13 | 845649 | 845819 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 14 | 955678 | 955848 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 15 | 1783902 | 1784072 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 16 | 2420153 | 2420323 | - | NZ_CP027770.1 | Staphylococcus felis |
| 17 | 17393 | 17563 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 18 | 948466 | 948636 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 19 | 1747110 | 1747283 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 20 | 1577836 | 1578009 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 21 | 1690562 | 1690735 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 22 | 1488750 | 1488917 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 23 | 661653 | 661820 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 24 | 745681 | 745848 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 25 | 1576648 | 1576821 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 26 | 407661 | 407834 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 27 | 897801 | 897974 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 28 | 1405038 | 1405208 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 29 | 1522651 | 1522824 | - | NZ_LT906464.1 | Staphylococcus muscae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134304.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01368.22 | 0.69 | 20 | 3613.0 | opposite-strand | DHH family |
| 2 | PF02833.16 | 0.69 | 20 | 3613.0 | opposite-strand | DHHA2 domain |
| 3 | PF00171.24 | 0.66 | 19 | 1924 | opposite-strand | Aldehyde dehydrogenase family |
| 4 | PF10282.11 | 0.72 | 21 | 720 | same-strand | Lactonase, 7-bladed beta-propeller |
| 5 | PF03417.18 | 0.97 | 28 | 503.0 | opposite-strand | Acyl-coenzyme A:6-aminopenicillanic acid acyl-transferase |
| 6 | PF13349.8 | 0.93 | 27 | 1688 | same-strand | Putative adhesin |
| 7 | PF08006.13 | 0.97 | 28 | 2529.0 | same-strand | Protein of unknown function (DUF1700) |
| 8 | PF14595.8 | 0.69 | 20 | 3719.0 | opposite-strand | Thioredoxin |
++ More..