| Protein Information | 
| Information Type | Description | 
|---|---|
| Protein name | 50S ribosomal protein L23 | 
| NCBI Accession ID | CP000805.1 | 
| Organism | Treponema pallidum subsp. pallidum (strain SS14) | 
| Left | 207456 | 
| Right | 207740 | 
| Strand | + | 
| Nucleotide Sequence | ATGGAACATACTGATGTAGTGATTGCTCCGGTGCTTACGGAGAAGTCGAATGCGCTGCGGCAACAGGGTAAGTACGTGTTCCGTGTTGCAGCTCGTGCGACAAAGATTCAGATTAAGCAGGCGGTGACGCAGCTTTTTGGAGTAACGGTTAGGCGGTGTACGGTAATGAATGTCTTTGGGAAGAAGAGGCGTGTTCGTCATCGGACCGGTAGGACGTCTGGGTGGAAGAAGGCGATCGTGCACGTTGCAGCAGGACAGTCAATTGGTGTTCTTGAGCGTGCATAG | 
| Sequence | MEHTDVVIAPVLTEKSNALRQQGKYVFRVAARATKIQIKQAVTQLFGVTVRRCTVMNVFGKKRRVRHRTGRTSGWKKAIVHVAAGQSIGVLERA | 
| Source of smORF | Swiss-Prot | 
| Function | One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome. {ECO:0000255|HAMAP-Rule:MF_01369}. | 
| Pubmed ID | 18482458 | 
| Domain | CDD:412311 | 
| Functional Category | Ribosomal_protein | 
| Uniprot ID | B2S2D8 | 
| ORF Length (Amino Acid) | 94 | 
| Conservation Analysis | 
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name | 
|---|---|---|---|---|---|
| 1 | 204837 | 205121 | + | NC_015714.1 | Treponema paraluiscuniculi Cuniculi A | 
| 2 | 2718580 | 2718864 | - | NC_022097.1 | Treponema pedis str. T A4 | 
| 3 | 491341 | 491625 | - | NZ_CP009228.1 | Treponema putidum | 
| 4 | 807774 | 808058 | + | NC_002967.9 | Treponema denticola ATCC 35405 | 
| 5 | 2698931 | 2699215 | - | NC_015500.1 | Treponema brennaborense DSM 12168 | 
| 6 | 538954 | 539184 | + | NZ_CP031518.1 | Treponema ruminis | 
| 7 | 344877 | 345161 | + | NZ_CP054142.1 | Treponema parvum | 
| 8 | 619266 | 619553 | + | NC_017583.1 | Spirochaeta thermophila DSM 6578 | 
| 9 | 2612294 | 2612578 | - | NC_015385.1 | Treponema succinifaciens DSM 2489 | 
| 10 | 661025 | 661309 | + | NC_017098.1 | Spirochaeta africana DSM 8902 | 
| 11 | 440869 | 441153 | + | NC_015732.1 | Treponema caldarium DSM 7334 | 
| 12 | 2812286 | 2812516 | - | NC_015578.1 | Treponema primitia ZAS-2 | 
| 13 | 3543014 | 3543247 | - | NC_015577.1 | Treponema azotonutricium ZAS-9 | 
| 14 | 3273631 | 3273915 | - | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 | 
| 15 | 1877751 | 1878005 | + | NZ_CP024201.1 | Caulobacter mirabilis | 
| 16 | 107095 | 107397 | + | NZ_LT635455.1 | Olsenella timonensis | 
| 17 | 193441 | 193722 | - | NZ_CP046314.1 | Gemella morbillorum | 
| 18 | 1129797 | 1130051 | + | NZ_CP029479.1 | Phenylobacterium parvum | 
| 19 | 1515070 | 1515354 | - | NC_013385.1 | Ammonifex degensii KC4 | 
| 20 | 1761659 | 1761940 | - | NZ_LR134484.1 | Gemella haemolysans | 
| 21 | 2602153 | 2602407 | - | NZ_CP044117.1 | Roseomonas mucosa | 
| 22 | 287869 | 288150 | + | NZ_CP030032.1 | Bradymonas sediminis | 
| 23 | 5606004 | 5606258 | - | NZ_CP043538.1 | Methylobacterium mesophilicum SR1.6/6 | 
| 24 | 173164 | 173394 | + | NZ_LN824141.1 | Defluviitoga tunisiensis | 
| 25 | 321049 | 321306 | + | NZ_CP010822.1 | Thermus aquaticus Y51MC23 | 
| 26 | 1564654 | 1564911 | - | NZ_CP038452.1 | Thermus caldilimi | 
| 27 | 874574 | 874804 | - | NC_016751.1 | Marinitoga piezophila KA3 | 
| 28 | 354642 | 354935 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 | 
| 29 | 2256120 | 2256413 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense | 
| 30 | 430827 | 431120 | + | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 | 
| 31 | 415983 | 416276 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 | 
| 32 | 882213 | 882503 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 | 
| 33 | 2422864 | 2423145 | - | NZ_CP021255.1 | Desulfobulbus oralis | 
| 34 | 400360 | 400602 | + | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 | 
| Neighborhood Conservation Analysis | 
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information | 
|---|---|---|---|---|---|---|
| 1 | PF00009.29 | 0.82 | 28 | 1835 | same-strand | Elongation factor Tu GTP binding domain | 
| 2 | PF03143.19 | 0.82 | 28 | 1717.5 | same-strand | Elongation factor Tu C-terminal domain | 
| 3 | PF03144.27 | 0.79 | 27 | 1822.5 | same-strand | Elongation factor Tu domain 2 | 
| 4 | PF01926.25 | 0.82 | 28 | 1737 | same-strand | 50S ribosome-binding GTPase | 
| 5 | PF00338.24 | 0.94 | 32 | 1344.5 | same-strand | Ribosomal protein S10p/S20e | 
| 6 | PF00573.24 | 1.0 | 34 | 3.0 | same-strand | Ribosomal protein L4/L1 family | 
| 7 | PF03947.20 | 1.0 | 34 | 26.0 | same-strand | Ribosomal Proteins L2, C-terminal domain | 
| 8 | PF00181.25 | 1.0 | 34 | 26.0 | same-strand | Ribosomal Proteins L2, RNA binding domain | 
| 9 | PF00203.23 | 0.94 | 32 | 874.0 | same-strand | Ribosomal protein S19 | 
| 10 | PF00237.21 | 0.97 | 33 | 1173 | same-strand | Ribosomal protein L22p/L17e | 
| 11 | PF00189.22 | 1.0 | 34 | 1525.5 | same-strand | Ribosomal protein S3, C-terminal domain | 
| 12 | PF07650.19 | 1.0 | 34 | 1525.5 | same-strand | KH domain | 
| 13 | PF00252.20 | 0.97 | 33 | 2271 | same-strand | Ribosomal protein L16p/L10e |