Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01271 |
NCBI Accession ID | NC_017381.1 |
Organism | Helicobacter pylori 2018 |
Left | 798558 |
Right | 798779 |
Strand | - |
Nucleotide Sequence | ATGGTAGAAGTGCGATTTTTTGGACCCATAAAAGAAGAAAATTTTTTCATCAAAGCGAATGATTTGAAAGAATTAAGAGCGATTTTACAAGAAAAAGAGGGCCTAAAAGAGTGGTTGGGCGTTTGCGCGATAGCCCTTAATGATCACCTGATAGACAATTTGGATACGCCTTTAAAAGATGGCGATGTGATCAGTTTATTACCACCGGTTTGTGGGGGCTAG |
Sequence | MVEVRFFGPIKEENFFIKANDLKELRAILQEKEGLKEWLGVCAIALNDHLIDNLDTPLKDGDVISLLPPVCGG |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of cl28922. Profile Description: Beta-grasp ubiquitin-like fold. This domain is the binding/interacting region of several protein kinases, such as the Schizosaccharomyces pombe Byr2. Byr2 is a Ser/Thr-specific protein kinase acting as mediator of signals for sexual differentiation in S. pombe by initiating a MAPK module, which is a highly conserved element in eukaryotes. Byr2 is activated by interacting with Ras, which then translocates the molecule to the plasma membrane. Ras proteins are key elements in intracellular signaling and are involved in a variety of vital processes such as DNA transcription, growth control, and differentiation. They function like molecular switches cycling between GTP-bound 'on' and GDP-bound 'off' states. |
Pubmed ID | 30796087 |
Domain | CDD:421700 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 73 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 806924 | 807145 | - | NC_017379.1 | Helicobacter pylori Puno135 |
2 | 1199905 | 1200126 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
3 | 1453143 | 1453364 | + | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
4 | 1501976 | 1502197 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
5 | 1456718 | 1456939 | + | NZ_CP053842.1 | Campylobacter corcagiensis |
6 | 818166 | 818387 | + | NZ_CP031611.1 | Campylobacter hepaticus |
7 | 340409 | 340630 | - | NZ_CP012543.1 | Campylobacter rectus |
8 | 329037 | 329258 | - | NZ_CP053848.1 | Campylobacter ornithocola |
9 | 542761 | 542982 | - | NC_014810.2 | Helicobacter felis ATCC 49179 |
10 | 1627048 | 1627275 | + | NZ_CP053826.1 | Campylobacter curvus |
11 | 212735 | 212956 | + | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
12 | 1645723 | 1645944 | + | NZ_CP053841.1 | Campylobacter blaseri |
13 | 335960 | 336181 | - | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
14 | 177211 | 177432 | - | NZ_CP059443.1 | Campylobacter fetus |
15 | 204557 | 204778 | - | NZ_CP010995.1 | Campylobacter iguaniorum |
16 | 492644 | 492865 | - | NZ_CP012196.1 | Campylobacter gracilis |
17 | 312692 | 312913 | - | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
18 | 1797953 | 1798174 | + | NZ_CP012544.1 | Campylobacter showae |
19 | 78401 | 78622 | + | NZ_CP027432.2 | Caminibacter pacificus |
20 | 151590 | 151811 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
21 | 325580 | 325801 | - | NC_012039.1 | Campylobacter lari RM2100 |
22 | 1189378 | 1189599 | + | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
23 | 2618564 | 2618785 | - | NZ_CP053835.1 | Arcobacter defluvii |
24 | 2347418 | 2347639 | - | NZ_CP042812.1 | Malaciobacter canalis |
25 | 82033 | 82254 | + | NC_012115.1 | Nautilia profundicola AmH |
26 | 997093 | 997314 | - | NZ_CP063079.1 | Campylobacter peloridis |
27 | 202977 | 203198 | + | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
28 | 2503056 | 2503277 | - | NZ_CP041070.1 | Arcobacter anaerophilus |
29 | 461529 | 461750 | + | NZ_CP036246.2 | [Arcobacter] porcinus |
30 | 1768954 | 1769175 | - | NZ_AP022826.1 | Nitrosophilus labii |
31 | 320021 | 320242 | - | NZ_CP053825.1 | Campylobacter armoricus |
32 | 956929 | 957150 | + | NZ_CP063087.1 | Helicobacter winghamensis |
33 | 122607 | 122828 | - | NZ_CP020478.1 | Campylobacter helveticus |
34 | 2400412 | 2400633 | - | NZ_CP032101.1 | Malaciobacter marinus |
35 | 934599 | 934820 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
36 | 1785954 | 1786175 | - | NC_017187.1 | Aliarcobacter butzleri ED-1 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00994.26 | 0.72 | 26 | 451.5 | same-strand | Probable molybdopterin binding domain |
2 | PF02391.19 | 1.0 | 36 | 3.5 | same-strand | MoaE protein |
3 | PF03453.19 | 0.64 | 23 | 452 | same-strand | MoeA N-terminal region (domain I and II) |