Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01269 |
NCBI Accession ID | NC_017340.1 |
Organism | Staphylococcus aureus 04-02981 |
Left | 1135347 |
Right | 1135601 |
Strand | + |
Nucleotide Sequence | ATGAATTTAATCCCAAGAACTAGTATTGTAGTTTATTTAAAACATATGAAACATGAACGACAAATCCGAAAATATGGACATATCGTTCATTCAAATAGAGATCGTAAATTTGTAATTATGTATGTGAATGAGCAGGATGTTGATCAAATTGTACATAAACTAATGCAACTTAAATACGTTAGACACATTGATGGCTCACCATATAAATACTTAAAGAAAACTTACGAAAAAGAGAAACACGAAATATATAATTAA |
Sequence | MNLIPRTSIVVYLKHMKHERQIRKYGHIVHSNRDRKFVIMYVNEQDVDQIVHKLMQLKYVRHIDGSPYKYLKKTYEKEKHEIYN |
Source of smORF | Protein-level |
Function | cytoplasm [GO:0005737] The ORF matches to the profile of cl23792. Profile Description: Uncharacterized protein conserved in bacteria (DUF2129). hypothetical protein; Provisional |
Pubmed ID | 30796087 |
Domain | CDD:420011 |
Functional Category | Gene Ontology/Expression based functional assignment |
Uniprot ID | Q6GHW4 |
ORF Length (Amino Acid) | 84 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1038192 | 1038446 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
2 | 1108752 | 1109006 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
3 | 430288 | 430539 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
4 | 1763014 | 1763265 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
5 | 1883238 | 1883489 | - | NZ_AP018587.1 | Staphylococcus caprae |
6 | 1699666 | 1699917 | - | NZ_LR134242.1 | Staphylococcus warneri |
7 | 2281045 | 2281296 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
8 | 655216 | 655467 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
9 | 1614297 | 1614548 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
10 | 1722952 | 1723203 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
11 | 793900 | 794151 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
12 | 1894163 | 1894369 | - | NZ_CP018776.1 | Staphylococcus condimenti |
13 | 1173893 | 1174099 | + | NZ_CP033460.1 | Staphylococcus debuckii |
14 | 1814746 | 1814997 | - | NZ_CP008724.1 | Staphylococcus xylosus |
15 | 1729041 | 1729292 | - | NZ_CP064056.1 | Staphylococcus lloydii |
16 | 1031833 | 1032084 | - | NZ_CP018199.1 | Staphylococcus succinus |
17 | 926465 | 926716 | + | NZ_CP013114.1 | Staphylococcus equorum |
18 | 194486 | 194737 | - | NZ_CP033732.1 | Staphylococcus hominis |
19 | 1087405 | 1087656 | + | NZ_LT906460.1 | Staphylococcus simiae |
20 | 1558498 | 1558749 | - | NZ_CP065712.1 | Staphylococcus auricularis |
21 | 2081985 | 2082230 | + | NZ_CP020773.1 | Staphylococcus lutrae |
22 | 95822 | 96073 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
23 | 1792403 | 1792651 | - | NZ_CP008747.1 | Staphylococcus hyicus |
24 | 740155 | 740409 | + | NZ_LT906464.1 | Staphylococcus muscae |
25 | 874894 | 875139 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
26 | 721614 | 721862 | + | NZ_CP045927.1 | Staphylococcus agnetis |
27 | 1595207 | 1595452 | + | NZ_CP027770.1 | Staphylococcus felis |
28 | 583754 | 584020 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
29 | 1574078 | 1574344 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
30 | 982215 | 982475 | + | NZ_CP054482.1 | Macrococcus bohemicus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01040.20 | 0.6 | 18 | 3446.5 | same-strand | UbiA prenyltransferase family |
2 | PF04238.14 | 0.83 | 25 | 3113 | same-strand | Protein of unknown function (DUF420) |
3 | PF14504.8 | 0.97 | 29 | 1625 | same-strand | CAP-associated N-terminal |
4 | PF00188.28 | 0.97 | 29 | 1625 | same-strand | Cysteine-rich secretory protein family |
5 | PF06133.13 | 0.97 | 29 | 1178 | same-strand | Control of competence regulator ComK, YlbF/YmcA |
6 | PF03009.19 | 0.97 | 29 | 159 | opposite-strand | Glycerophosphoryl diester phosphodiesterase family |
7 | PF03602.17 | 1.0 | 30 | 471.0 | same-strand | Conserved hypothetical protein 95 |
8 | PF01467.28 | 1.0 | 30 | 1016.5 | same-strand | Cytidylyltransferase-like |
9 | PF05636.13 | 1.0 | 30 | 1624.5 | opposite-strand | HIGH Nucleotidyl Transferase |
10 | PF02620.19 | 0.9 | 27 | 2844 | same-strand | Large ribosomal RNA subunit accumulation protein YceD |