ProsmORF-pred
Result : EXP01269
Protein Information
Information Type Description
Protein name EXP01269
NCBI Accession ID NC_017340.1
Organism Staphylococcus aureus 04-02981
Left 1135347
Right 1135601
Strand +
Nucleotide Sequence ATGAATTTAATCCCAAGAACTAGTATTGTAGTTTATTTAAAACATATGAAACATGAACGACAAATCCGAAAATATGGACATATCGTTCATTCAAATAGAGATCGTAAATTTGTAATTATGTATGTGAATGAGCAGGATGTTGATCAAATTGTACATAAACTAATGCAACTTAAATACGTTAGACACATTGATGGCTCACCATATAAATACTTAAAGAAAACTTACGAAAAAGAGAAACACGAAATATATAATTAA
Sequence MNLIPRTSIVVYLKHMKHERQIRKYGHIVHSNRDRKFVIMYVNEQDVDQIVHKLMQLKYVRHIDGSPYKYLKKTYEKEKHEIYN
Source of smORF Protein-level
Function cytoplasm [GO:0005737]
The ORF matches to the profile of cl23792. Profile Description: Uncharacterized protein conserved in bacteria (DUF2129). hypothetical protein; Provisional
Pubmed ID 30796087
Domain CDD:420011
Functional Category Gene Ontology/Expression based functional assignment
Uniprot ID Q6GHW4
ORF Length (Amino Acid) 84
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 30
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1038192 1038446 + NC_007795.1 Staphylococcus aureus subsp. aureus NCTC 8325
2 1108752 1109006 + NZ_LR134304.1 Staphylococcus schweitzeri
3 430288 430539 + NZ_CP007601.1 Staphylococcus capitis subsp. capitis
4 1763014 1763265 - NZ_CP035288.1 Staphylococcus epidermidis
5 1883238 1883489 - NZ_AP018587.1 Staphylococcus caprae
6 1699666 1699917 - NZ_LR134242.1 Staphylococcus warneri
7 2281045 2281296 + NC_022737.1 Staphylococcus pasteuri SP1
8 655216 655467 - NZ_CP014022.1 Staphylococcus lugdunensis
9 1614297 1614548 + NZ_CP066042.1 Staphylococcus saccharolyticus
10 1722952 1723203 - NZ_LR134089.1 Staphylococcus saprophyticus
11 793900 794151 + NZ_CP013911.1 Staphylococcus haemolyticus
12 1894163 1894369 - NZ_CP018776.1 Staphylococcus condimenti
13 1173893 1174099 + NZ_CP033460.1 Staphylococcus debuckii
14 1814746 1814997 - NZ_CP008724.1 Staphylococcus xylosus
15 1729041 1729292 - NZ_CP064056.1 Staphylococcus lloydii
16 1031833 1032084 - NZ_CP018199.1 Staphylococcus succinus
17 926465 926716 + NZ_CP013114.1 Staphylococcus equorum
18 194486 194737 - NZ_CP033732.1 Staphylococcus hominis
19 1087405 1087656 + NZ_LT906460.1 Staphylococcus simiae
20 1558498 1558749 - NZ_CP065712.1 Staphylococcus auricularis
21 2081985 2082230 + NZ_CP020773.1 Staphylococcus lutrae
22 95822 96073 + NZ_CP022096.2 Staphylococcus pettenkoferi
23 1792403 1792651 - NZ_CP008747.1 Staphylococcus hyicus
24 740155 740409 + NZ_LT906464.1 Staphylococcus muscae
25 874894 875139 + NC_014925.1 Staphylococcus pseudintermedius HKU10-03
26 721614 721862 + NZ_CP045927.1 Staphylococcus agnetis
27 1595207 1595452 + NZ_CP027770.1 Staphylococcus felis
28 583754 584020 + NZ_CP068061.1 Mammaliicoccus vitulinus
29 1574078 1574344 - NZ_CP022046.2 Mammaliicoccus sciuri
30 982215 982475 + NZ_CP054482.1 Macrococcus bohemicus
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_007795.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF01040.20 0.6 18 3446.5 same-strand UbiA prenyltransferase family
2 PF04238.14 0.83 25 3113 same-strand Protein of unknown function (DUF420)
3 PF14504.8 0.97 29 1625 same-strand CAP-associated N-terminal
4 PF00188.28 0.97 29 1625 same-strand Cysteine-rich secretory protein family
5 PF06133.13 0.97 29 1178 same-strand Control of competence regulator ComK, YlbF/YmcA
6 PF03009.19 0.97 29 159 opposite-strand Glycerophosphoryl diester phosphodiesterase family
7 PF03602.17 1.0 30 471.0 same-strand Conserved hypothetical protein 95
8 PF01467.28 1.0 30 1016.5 same-strand Cytidylyltransferase-like
9 PF05636.13 1.0 30 1624.5 opposite-strand HIGH Nucleotidyl Transferase
10 PF02620.19 0.9 27 2844 same-strand Large ribosomal RNA subunit accumulation protein YceD
++ More..