Result : EXP01268
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01268 |
| NCBI Accession ID | NC_017548.1 |
| Organism | Pseudomonas aeruginosa M18 |
| Left | 6190560 |
| Right | 6190763 |
| Strand | + |
| Nucleotide Sequence | ATGGAACGTACCCTCGGTTCCAACACTTTCGACATCGCTCGCTCCAACCGCCGCAGCAGCAGCCTGCTGGGCACCATGAAACTGTGGCAGCGCCGCATCCAGAGCCGTCGCCAGCTGGCCCGCCTGGACTCCCGCCTGCTCGCCGACGCCGGCATCAGCGAAGCCCAGCGCTACGCCGAGCTGAACAAGCCGTTCTGGCGCTAA |
| Sequence | MERTLGSNTFDIARSNRRSSSLLGTMKLWQRRIQSRRQLARLDSRLLADAGISEAQRYAELNKPFWR |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl23975. Profile Description: Domain of unknown function (DUF1127). This family is found in several hypothetical bacterial proteins. In some cases it represents it represents the C-terminal region whereas in others it represents the whole sequence. |
| Pubmed ID | 30796087 |
| Domain | CDD:420128 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 51
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 6135709 | 6135912 | + | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 2 | 182300 | 182506 | + | NZ_CP014158.1 | Pseudomonas citronellolis |
| 3 | 479475 | 479681 | + | NZ_CP048833.1 | Pseudomonas multiresinivorans |
| 4 | 58998 | 59204 | - | NZ_CP047698.1 | Pseudomonas knackmussii |
| 5 | 4022005 | 4022220 | + | NZ_CP048810.1 | Pseudomonas bijieensis |
| 6 | 165783 | 165998 | - | NZ_CP034725.1 | Pseudomonas brassicacearum |
| 7 | 314859 | 315071 | - | NZ_CP054205.1 | Pseudomonas rhodesiae |
| 8 | 613439 | 613654 | + | NZ_CP049044.1 | Pseudomonas psychrophila |
| 9 | 110478 | 110693 | - | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 10 | 45061 | 45276 | - | NZ_CP014870.1 | Pseudomonas silesiensis |
| 11 | 135937 | 136152 | - | NZ_CP035088.1 | Pseudomonas viciae |
| 12 | 113485 | 113700 | - | NZ_LS999205.1 | Pseudomonas protegens CHA0 |
| 13 | 4811524 | 4811739 | + | NZ_CP062158.2 | Pseudomonas lundensis |
| 14 | 6493287 | 6493502 | + | NZ_CP012400.2 | Pseudomonas yamanorum |
| 15 | 4435209 | 4435424 | + | NZ_CP012676.1 | Pseudomonas versuta |
| 16 | 231173 | 231388 | - | NZ_CP051487.1 | Pseudomonas umsongensis |
| 17 | 3788731 | 3788946 | + | NZ_CP005960.1 | Pseudomonas mandelii JR-1 |
| 18 | 274799 | 275014 | - | NZ_CP046621.1 | Pseudomonas alkylphenolica |
| 19 | 114092 | 114307 | - | NZ_CP029608.1 | Pseudomonas kribbensis |
| 20 | 107930 | 108145 | - | NZ_CP062252.1 | Pseudomonas allokribbensis |
| 21 | 2581123 | 2581338 | + | NZ_CP014205.2 | Pseudomonas glycinae |
| 22 | 109833 | 110048 | - | NZ_CP027756.1 | Pseudomonas synxantha |
| 23 | 118992 | 119207 | - | NZ_CP018420.1 | Pseudomonas veronii |
| 24 | 109700 | 109915 | - | NZ_CP027723.1 | Pseudomonas orientalis |
| 25 | 109531 | 109746 | - | NZ_CP023272.1 | Pseudomonas lurida |
| 26 | 109286 | 109501 | - | NZ_CP010896.1 | Pseudomonas simiae |
| 27 | 3676102 | 3676317 | - | NZ_CP014262.1 | Pseudomonas corrugata |
| 28 | 122911 | 123123 | - | NZ_CP024159.1 | Pseudomonas mosselii |
| 29 | 105450 | 105662 | - | NC_008027.1 | Pseudomonas entomophila L48 |
| 30 | 5247252 | 5247464 | - | NZ_CP009365.1 | Pseudomonas soli |
| 31 | 6228554 | 6228769 | + | NC_004578.1 | Pseudomonas syringae pv. tomato str. DC3000 |
| 32 | 8973 | 9188 | + | NZ_CP070503.1 | Pseudomonas atacamensis |
| 33 | 126411 | 126626 | - | NZ_CP062253.1 | Pseudomonas gozinkensis |
| 34 | 5868919 | 5869134 | + | NZ_CP007039.1 | Pseudomonas cichorii JBC1 |
| 35 | 257313 | 257528 | - | NZ_CP071706.1 | Pseudomonas donghuensis |
| 36 | 5856599 | 5856814 | + | NZ_CP067022.1 | Pseudomonas cannabina pv. alisalensis |
| 37 | 102972 | 103187 | - | NZ_LR215729.2 | Pseudomonas marincola |
| 38 | 108839 | 109054 | - | NZ_CP022562.1 | Pseudomonas monteilii |
| 39 | 154377 | 154592 | - | NC_021505.1 | Pseudomonas putida NBRC 14164 |
| 40 | 135209 | 135424 | - | NZ_CP043311.1 | Pseudomonas lalkuanensis |
| 41 | 5879447 | 5879662 | + | NZ_CP068034.2 | Pseudomonas syringae |
| 42 | 5921497 | 5921712 | + | NZ_CP042804.1 | Pseudomonas amygdali pv. tabaci str. ATCC 11528 |
| 43 | 3529339 | 3529551 | + | NZ_CP009533.1 | Pseudomonas rhizosphaerae |
| 44 | 1989949 | 1990164 | + | NZ_CP070505.1 | Pseudomonas toyotomiensis |
| 45 | 6000367 | 6000582 | + | NZ_AP022642.1 | Pseudomonas otitidis |
| 46 | 3541365 | 3541580 | + | NZ_CP031146.1 | Pseudomonas plecoglossicida |
| 47 | 197649 | 197864 | - | NZ_CP013124.1 | Pseudomonas mendocina S5.2 |
| 48 | 5184899 | 5185114 | + | NZ_CP068551.1 | Pseudomonas khazarica |
| 49 | 515356 | 515571 | - | NZ_CP060009.1 | Pseudomonas sediminis |
| 50 | 97200 | 97415 | - | NZ_AP014862.1 | Pseudomonas furukawaii |
| 51 | 109225 | 109440 | - | NZ_CP056030.1 | Pseudomonas eucalypticola |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP048810.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13336.8 | 0.84 | 43 | 321 | same-strand | Acetyl-CoA hydrolase/transferase C-terminal domain |
| 2 | PF02550.17 | 0.86 | 44 | 321.0 | same-strand | Acetyl-CoA hydrolase/transferase N-terminal domain |
| 3 | PF01262.23 | 0.92 | 47 | 3780 | same-strand | Alanine dehydrogenase/PNT, C-terminal domain |
| 4 | PF05222.17 | 0.92 | 47 | 3780 | same-strand | Alanine dehydrogenase/PNT, N-terminal domain |
| 5 | PF12769.9 | 0.92 | 47 | 3446 | same-strand | 4TM region of pyridine nucleotide transhydrogenase, mitoch |
| 6 | PF02233.18 | 0.92 | 47 | 1996 | same-strand | NAD(P) transhydrogenase beta subunit |
| 7 | PF13387.8 | 0.94 | 48 | 1410.0 | same-strand | Domain of unknown function (DUF4105) |
| 8 | PF09498.12 | 0.94 | 48 | 758.5 | same-strand | Protein of unknown function (DUF2388) |
| 9 | PF03466.22 | 0.8 | 41 | 5336 | same-strand | LysR substrate binding domain |
| 10 | PF00126.29 | 0.8 | 41 | 5336 | same-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
++ More..