ProsmORF-pred
Result : EXP01267
Protein Information
Information Type Description
Protein name EXP01267
NCBI Accession ID NC_017340.1
Organism Staphylococcus aureus 04-02981
Left 869010
Right 869204
Strand +
Nucleotide Sequence ATGGCAGACGAAAGTAAATTTGAACAAGCAAAAGGTAATGTTAAAGAAACAGTAGGTAATGTTACTGATAATAAAAATTTAGAAAACGAAGGTAAAGAAGATAAAGCTTCTGGTAAAGCGAAAGAATTCGTTGAAAATGCAAAAGAAAAAGCAACTGATTTTATTGATAAAGTAAAAGGTAACAAAGGCGAGTAA
Sequence MADESKFEQAKGNVKETVGNVTDNKNLENEGKEDKASGKAKEFVENAKEKATDFIDKVKGNKGE
Source of smORF Protein-level
Function The ORF matches to the profile of cl22912. Profile Description: CsbD-like. hypothetical protein; Provisional
Pubmed ID 30796087
Domain CDD:419889
Functional Category Conserved domain based functional assignment
Uniprot ID Q5HHH4
ORF Length (Amino Acid) 64
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 44
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 816026 816220 + NC_007795.1 Staphylococcus aureus subsp. aureus NCTC 8325
2 1635849 1636031 - NC_007795.1 Staphylococcus aureus subsp. aureus NCTC 8325
3 885021 885215 + NZ_LR134304.1 Staphylococcus schweitzeri
4 1700344 1700526 - NZ_LR134304.1 Staphylococcus schweitzeri
5 835184 835378 + NZ_LT906460.1 Staphylococcus simiae
6 2109720 2109917 - NZ_AP018587.1 Staphylococcus caprae
7 1306413 1306595 + NZ_AP018587.1 Staphylococcus caprae
8 554407 554589 - NZ_CP022096.2 Staphylococcus pettenkoferi
9 1910466 1910657 + NZ_CP022096.2 Staphylococcus pettenkoferi
10 1500604 1500786 - NZ_CP013114.1 Staphylococcus equorum
11 1212198 1212380 + NZ_LR134089.1 Staphylococcus saprophyticus
12 2064463 2064663 - NZ_CP027770.1 Staphylococcus felis
13 1288980 1289162 + NZ_CP008724.1 Staphylococcus xylosus
14 2052805 2052987 + NZ_CP008724.1 Staphylococcus xylosus
15 174864 175052 + NZ_CP007601.1 Staphylococcus capitis subsp. capitis
16 444915 445097 + NZ_CP018199.1 Staphylococcus succinus
17 303598 303780 + NZ_CP068061.1 Mammaliicoccus vitulinus
18 1259509 1259691 + NZ_CP064056.1 Staphylococcus lloydii
19 1939869 1940051 - NZ_LT906462.1 Mammaliicoccus stepanovicii
20 1401813 1402004 + NZ_CP066042.1 Staphylococcus saccharolyticus
21 584480 584674 + NZ_CP013911.1 Staphylococcus haemolyticus
22 1981300 1981491 - NZ_CP035288.1 Staphylococcus epidermidis
23 1859659 1859841 - NZ_CP022046.2 Mammaliicoccus sciuri
24 912027 912230 - NZ_CP014022.1 Staphylococcus lugdunensis
25 1435115 1435300 - NC_014925.1 Staphylococcus pseudintermedius HKU10-03
26 423740 423925 - NZ_CP033732.1 Staphylococcus hominis
27 1095665 1095850 + NZ_CP065712.1 Staphylococcus auricularis
28 1049623 1049814 + NZ_LT906464.1 Staphylococcus muscae
29 1694444 1694650 - NZ_CP033460.1 Staphylococcus debuckii
30 84080 84265 - NZ_CP020773.1 Staphylococcus lutrae
31 1902275 1902442 - NZ_LR134242.1 Staphylococcus warneri
32 2034633 2034800 + NC_022737.1 Staphylococcus pasteuri SP1
33 1399798 1400004 + NZ_CP018776.1 Staphylococcus condimenti
34 336188 336370 + NZ_CP047361.1 Macrococcus canis
35 2028982 2029164 + NZ_CP065729.1 Macrococcus caseolyticus
36 1316263 1316427 + NZ_CP008747.1 Staphylococcus hyicus
37 347022 347210 + NZ_CP054482.1 Macrococcus bohemicus
38 1240011 1240196 - NZ_CP045927.1 Staphylococcus agnetis
39 1571810 1572022 + NZ_AP018400.1 Streptococcus ruminantium
40 2440365 2440556 - NZ_CP016843.1 Carnobacterium divergens
41 3605853 3606023 - NZ_CP022163.1 Melittangium boletus DSM 14713
42 2213588 2213755 + NZ_CP060716.1 Leucobacter denitrificans
43 1738440 1738643 + NZ_LS483403.1 Streptococcus lutetiensis
44 563320 563517 - NZ_CP029487.1 Eubacterium maltosivorans
45 3651741 3651938 - NZ_CP019962.1 Eubacterium limosum
46 1919506 1919706 - NC_014624.2 Eubacterium callanderi
47 316857 317054 + NZ_CP014161.1 Aerococcus urinae
48 1839952 1840140 + NZ_CP034549.1 Nonlabens ponticola
49 1761121 1761297 - NC_004369.1 Corynebacterium efficiens YS-314
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_007795.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00266.21 0.61 27 3323.0 same-strand Aminotransferase class-V
++ More..