Result : EXP01264
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01264 |
| NCBI Accession ID | NZ_CP009472.1 |
| Organism | Lactococcus lactis strain AI06 |
| Left | 2133510 |
| Right | 2133731 |
| Strand | + |
| Nucleotide Sequence | ATGATTGAATTATTTAAAGACTTAAAAAATATCATTGGCGAGTTGTCAGAAGAAGTCAACACGATGAAAATAAGGGTTGACCGCGTGCAAGAAGAAAGTATCAAAGCAGCACAAGTTGGTAAAGATATTCAAAAAAAGGTAGATGAATTTCAAATTTCTATTCAACCAAGAGTGGAAAAGATAAACGAGCTTATTAATCAAATAAATAAAAGGGTTGAATAA |
| Sequence | MIELFKDLKNIIGELSEEVNTMKIRVDRVQEESIKAAQVGKDIQKKVDEFQISIQPRVEKINELINQINKRVE |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2133273 | 2133494 | + | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 2 | 1899688 | 1899909 | + | NZ_CP070872.1 | Lactococcus taiwanensis |
| 3 | 1730126 | 1730347 | + | NZ_CP032627.1 | Lactococcus allomyrinae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP032627.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03932.16 | 1.0 | 3 | 3010 | same-strand | CutC family |
| 2 | PF00005.29 | 1.0 | 3 | 1761.0 | opposite-strand | ABC transporter |
| 3 | PF01230.25 | 1.0 | 3 | 15 | same-strand | HIT domain |
| 4 | PF11969.10 | 1.0 | 3 | 15 | same-strand | Scavenger mRNA decapping enzyme C-term binding |
| 5 | PF00687.23 | 0.67 | 2 | 436.0 | opposite-strand | Ribosomal protein L1p/L10e family |
| 6 | PF03946.16 | 0.67 | 2 | 1419.0 | opposite-strand | Ribosomal protein L11, N-terminal domain |
| 7 | PF00298.21 | 0.67 | 2 | 1419.0 | opposite-strand | Ribosomal protein L11, RNA binding domain |
| 8 | PF08241.14 | 0.67 | 2 | 3490.0 | opposite-strand | Methyltransferase domain |
| 9 | PF13649.8 | 0.67 | 2 | 3490.0 | opposite-strand | Methyltransferase domain |
++ More..