Result : EXP01259
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01259 |
| NCBI Accession ID | NC_017548.1 |
| Organism | Pseudomonas aeruginosa M18 |
| Left | 5804982 |
| Right | 5805284 |
| Strand | - |
| Nucleotide Sequence | GTGCCAAGCTGTAGGGCAGCGCTTCCCCCGAACAAGGAGTTCCTCATGGCGTCGTTCCGTACCCTGGCCGTGGTCGCTTTCTGCGTCGTCCTGGCCGCCTGCAGCAAGATCAACCAGGAAAACTATTCCAAGCTCAAGGCCGGCATGAGCAAGGCCGAGGTCGAGGCGATCCTCGGCAAGCCCACCGAGTGCTCCGGCGCGCTGGGCATGTCCAGTTGCACCTGGGGCGACGAGAAGGCTTTCATCAGCGTGCAGTACGCGGCCGACAAGGCGCTGCTCTTCTCCGGCCAGGGGCTCAAGTGA |
| Sequence | VPSCRAALPPNKEFLMASFRTLAVVAFCVVLAACSKINQENYSKLKAGMSKAEVEAILGKPTECSGALGMSSCTWGDEKAFISVQYAADKALLFSGQGLK |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 40
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5751527 | 5751829 | - | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 2 | 1128234 | 1128488 | + | NZ_CP048833.1 | Pseudomonas multiresinivorans |
| 3 | 5658253 | 5658507 | - | NZ_CP070503.1 | Pseudomonas atacamensis |
| 4 | 270208 | 270462 | + | NZ_CP014870.1 | Pseudomonas silesiensis |
| 5 | 396437 | 396691 | + | NZ_CP023272.1 | Pseudomonas lurida |
| 6 | 456329 | 456583 | + | NZ_CP051487.1 | Pseudomonas umsongensis |
| 7 | 460511 | 460765 | + | NZ_LS999205.1 | Pseudomonas protegens CHA0 |
| 8 | 6525401 | 6525655 | - | NZ_CP014158.1 | Pseudomonas citronellolis |
| 9 | 379019 | 379273 | + | NZ_CP010896.1 | Pseudomonas simiae |
| 10 | 418256 | 418510 | + | NZ_CP018420.1 | Pseudomonas veronii |
| 11 | 625231 | 625485 | + | NZ_CP054205.1 | Pseudomonas rhodesiae |
| 12 | 431489 | 431776 | + | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 13 | 3926019 | 3926273 | + | NZ_CP014262.1 | Pseudomonas corrugata |
| 14 | 3524994 | 3525248 | - | NZ_CP005960.1 | Pseudomonas mandelii JR-1 |
| 15 | 430401 | 430655 | + | NZ_CP062253.1 | Pseudomonas gozinkensis |
| 16 | 422470 | 422724 | + | NZ_CP062252.1 | Pseudomonas allokribbensis |
| 17 | 5510034 | 5510288 | + | NZ_CP014205.2 | Pseudomonas glycinae |
| 18 | 438391 | 438645 | + | NZ_CP029608.1 | Pseudomonas kribbensis |
| 19 | 388153 | 388407 | + | NZ_CP027723.1 | Pseudomonas orientalis |
| 20 | 4629702 | 4629950 | - | NZ_CP062158.2 | Pseudomonas lundensis |
| 21 | 3736131 | 3736385 | - | NZ_CP048810.1 | Pseudomonas bijieensis |
| 22 | 387788 | 388042 | + | NZ_CP035088.1 | Pseudomonas viciae |
| 23 | 394027 | 394275 | - | NZ_CP049044.1 | Pseudomonas psychrophila |
| 24 | 453163 | 453417 | + | NZ_CP034725.1 | Pseudomonas brassicacearum |
| 25 | 4249633 | 4249881 | - | NZ_CP012676.1 | Pseudomonas versuta |
| 26 | 406361 | 406609 | - | NZ_CP068034.2 | Pseudomonas syringae |
| 27 | 387662 | 387916 | + | NZ_CP027756.1 | Pseudomonas synxantha |
| 28 | 5886310 | 5886558 | + | NC_004578.1 | Pseudomonas syringae pv. tomato str. DC3000 |
| 29 | 319826 | 320074 | - | NZ_CP042804.1 | Pseudomonas amygdali pv. tabaci str. ATCC 11528 |
| 30 | 5666510 | 5666764 | - | NZ_CP047698.1 | Pseudomonas knackmussii |
| 31 | 5456572 | 5456820 | + | NZ_CP067022.1 | Pseudomonas cannabina pv. alisalensis |
| 32 | 6181937 | 6182191 | - | NZ_CP012400.2 | Pseudomonas yamanorum |
| 33 | 5664061 | 5664315 | - | NZ_CP043311.1 | Pseudomonas lalkuanensis |
| 34 | 5639384 | 5639632 | + | NZ_CP007039.1 | Pseudomonas cichorii JBC1 |
| 35 | 430663 | 430911 | + | NZ_CP056030.1 | Pseudomonas eucalypticola |
| 36 | 5784199 | 5784447 | - | NZ_AP014862.1 | Pseudomonas furukawaii |
| 37 | 522827 | 523072 | + | NZ_CP068551.1 | Pseudomonas khazarica |
| 38 | 5698737 | 5698991 | - | NZ_AP022642.1 | Pseudomonas otitidis |
| 39 | 4411982 | 4412242 | - | NZ_LR215729.2 | Pseudomonas marincola |
| 40 | 2271130 | 2271375 | - | NZ_CP037953.1 | Permianibacter aggregans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002516.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05962.13 | 0.85 | 34 | 2935.5 | same-strand | HutD |
| 2 | PF07702.15 | 0.85 | 34 | 2189.0 | same-strand | UTRA domain |
| 3 | PF00392.23 | 0.85 | 34 | 2189.0 | same-strand | Bacterial regulatory proteins, gntR family |
| 4 | PF01979.22 | 0.85 | 34 | 716.5 | opposite-strand | Amidohydrolase family |
| 5 | PF08212.14 | 0.97 | 39 | 31 | same-strand | Lipocalin-like domain |
| 6 | PF00061.25 | 0.82 | 33 | 32 | same-strand | Lipocalin / cytosolic fatty-acid binding protein family |
| 7 | PF06041.13 | 0.6 | 24 | 2238.0 | same-strand | Bacterial protein of unknown function (DUF924) |
| 8 | PF00316.22 | 0.97 | 39 | 679 | same-strand | Fructose-1-6-bisphosphatase, N-terminal domain |
| 9 | PF18913.2 | 0.97 | 39 | 679 | same-strand | Fructose-1-6-bisphosphatase, C-terminal domain |
| 10 | PF13163.8 | 0.75 | 30 | 3791.0 | same-strand | Protein of unknown function (DUF3999) |
++ More..