Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01258 |
NCBI Accession ID | NC_017381.1 |
Organism | Helicobacter pylori 2018 |
Left | 546844 |
Right | 547089 |
Strand | + |
Nucleotide Sequence | ATGGAATTAGGAAATAAAAATATAAAACCCGGTCGTAAGCGTGTCGCTGTAGATGAGTTGAAACGCAATTTTTCAGTGACTTTTTATCTCTCTAAAGAAGAGCATGATGTTTTGAGACGCTTAGCTGATGAAGAAGTAGAAAGCGTCAATTCTTTTGTCAAACGCCACATTTTAAAAACGATCATTTACAAAAAAGGCACTAACCAAGATTCTTCTATCAATTGTGATTCTTCTAGTAGGCTTTAA |
Sequence | MELGNKNIKPGRKRVAVDELKRNFSVTFYLSKEEHDVLRRLADEEVESVNSFVKRHILKTIIYKKGTNQDSSINCDSSSRL |
Source of smORF | Protein-level |
Function | |
Pubmed ID | 30796087 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 81 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 553964 | 554206 | + | NC_017379.1 | Helicobacter pylori Puno135 |
2 | 679065 | 679283 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
3 | 292914 | 293117 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00109.28 | 1.0 | 3 | 3140 | opposite-strand | Beta-ketoacyl synthase, N-terminal domain |
2 | PF02801.24 | 1.0 | 3 | 3140 | opposite-strand | Beta-ketoacyl synthase, C-terminal domain |
3 | PF00550.27 | 1.0 | 3 | 2753 | opposite-strand | Phosphopantetheine attachment site |
4 | PF13561.8 | 1.0 | 3 | 1792 | opposite-strand | Enoyl-(Acyl carrier protein) reductase |
5 | PF00106.27 | 1.0 | 3 | 1792 | opposite-strand | short chain dehydrogenase |
6 | PF08659.12 | 1.0 | 3 | 1792 | opposite-strand | KR domain |
7 | PF01165.22 | 1.0 | 3 | 1525 | opposite-strand | Ribosomal protein S21 |
8 | PF04224.14 | 1.0 | 3 | 34 | opposite-strand | Protein of unknown function, DUF417 |
9 | PF01678.21 | 1.0 | 3 | 797 | opposite-strand | Diaminopimelate epimerase |
10 | PF01594.18 | 1.0 | 3 | 1719 | same-strand | AI-2E family transporter |
11 | PF13186.8 | 0.67 | 2 | 2823.5 | opposite-strand | Iron-sulfur cluster-binding domain |
12 | PF06071.15 | 0.67 | 2 | 3765.0 | opposite-strand | Protein of unknown function (DUF933) |
13 | PF01926.25 | 0.67 | 2 | 3765.0 | opposite-strand | 50S ribosome-binding GTPase |