Result : EXP01258
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01258 |
| NCBI Accession ID | NC_017381.1 |
| Organism | Helicobacter pylori 2018 |
| Left | 546844 |
| Right | 547089 |
| Strand | + |
| Nucleotide Sequence | ATGGAATTAGGAAATAAAAATATAAAACCCGGTCGTAAGCGTGTCGCTGTAGATGAGTTGAAACGCAATTTTTCAGTGACTTTTTATCTCTCTAAAGAAGAGCATGATGTTTTGAGACGCTTAGCTGATGAAGAAGTAGAAAGCGTCAATTCTTTTGTCAAACGCCACATTTTAAAAACGATCATTTACAAAAAAGGCACTAACCAAGATTCTTCTATCAATTGTGATTCTTCTAGTAGGCTTTAA |
| Sequence | MELGNKNIKPGRKRVAVDELKRNFSVTFYLSKEEHDVLRRLADEEVESVNSFVKRHILKTIIYKKGTNQDSSINCDSSSRL |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 81 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 553964 | 554206 | + | NC_017379.1 | Helicobacter pylori Puno135 |
| 2 | 679065 | 679283 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 3 | 292914 | 293117 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017379.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00109.28 | 1.0 | 3 | 3140 | opposite-strand | Beta-ketoacyl synthase, N-terminal domain |
| 2 | PF02801.24 | 1.0 | 3 | 3140 | opposite-strand | Beta-ketoacyl synthase, C-terminal domain |
| 3 | PF00550.27 | 1.0 | 3 | 2753 | opposite-strand | Phosphopantetheine attachment site |
| 4 | PF13561.8 | 1.0 | 3 | 1792 | opposite-strand | Enoyl-(Acyl carrier protein) reductase |
| 5 | PF00106.27 | 1.0 | 3 | 1792 | opposite-strand | short chain dehydrogenase |
| 6 | PF08659.12 | 1.0 | 3 | 1792 | opposite-strand | KR domain |
| 7 | PF01165.22 | 1.0 | 3 | 1525 | opposite-strand | Ribosomal protein S21 |
| 8 | PF04224.14 | 1.0 | 3 | 34 | opposite-strand | Protein of unknown function, DUF417 |
| 9 | PF01678.21 | 1.0 | 3 | 797 | opposite-strand | Diaminopimelate epimerase |
| 10 | PF01594.18 | 1.0 | 3 | 1719 | same-strand | AI-2E family transporter |
| 11 | PF13186.8 | 0.67 | 2 | 2823.5 | opposite-strand | Iron-sulfur cluster-binding domain |
| 12 | PF06071.15 | 0.67 | 2 | 3765.0 | opposite-strand | Protein of unknown function (DUF933) |
| 13 | PF01926.25 | 0.67 | 2 | 3765.0 | opposite-strand | 50S ribosome-binding GTPase |
++ More..