Result : EXP01256
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01256 |
| NCBI Accession ID | NC_017340.1 |
| Organism | Staphylococcus aureus 04-02981 |
| Left | 1318414 |
| Right | 1318629 |
| Strand | - |
| Nucleotide Sequence | ATGTCTATTAATATTGATCCAGAAAAATTTGCAGAATTAGTGGTTATGTCTAACCCATCAAAATTCGAAGATGCAGAGGATATAGCTAAAGAAAGTTTAAAGCTTTACATTAATGCATATCGTTTAGCAGAGAGATATTCAACAATTGCAACAAATTGTTATGATACTGCAGAAGTTATAAAAGAATTAAAGAAAACAGATTTACAATTAAAATAA |
| Sequence | MSINIDPEKFAELVVMSNPSKFEDAEDIAKESLKLYINAYRLAERYSTIATNCYDTAEVIKELKKTDLQLK |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 29
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1219476 | 1219691 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1290255 | 1290470 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 1247327 | 1247542 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 1546216 | 1546431 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 5 | 2434478 | 2434693 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 6 | 950035 | 950250 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 7 | 34494 | 34709 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 8 | 495568 | 495786 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 9 | 1605932 | 1606147 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 10 | 1668563 | 1668778 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 11 | 1547202 | 1547417 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 12 | 1146790 | 1147008 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 13 | 601589 | 601804 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 14 | 1770581 | 1770796 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 15 | 1567879 | 1568094 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 16 | 854739 | 854954 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 17 | 1641605 | 1641820 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 18 | 1401793 | 1402008 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 19 | 1705985 | 1706203 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 20 | 1388215 | 1388433 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 21 | 934789 | 935007 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 22 | 1626098 | 1626316 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 23 | 1076242 | 1076460 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 24 | 250307 | 250525 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 25 | 1767736 | 1767960 | - | NZ_CP027770.1 | Staphylococcus felis |
| 26 | 2285102 | 2285320 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 27 | 1466365 | 1466583 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 28 | 787623 | 787841 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 29 | 1374883 | 1375101 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13413.8 | 0.79 | 23 | 5315 | opposite-strand | Helix-turn-helix domain |
| 2 | PF12844.9 | 0.79 | 23 | 5315 | opposite-strand | Helix-turn-helix domain |
| 3 | PF13560.8 | 0.62 | 18 | 5306.0 | opposite-strand | Helix-turn-helix domain |
| 4 | PF01066.23 | 0.83 | 24 | 4706.5 | opposite-strand | CDP-alcohol phosphatidyltransferase |
| 5 | PF00994.26 | 0.9 | 26 | 3350.5 | opposite-strand | Probable molybdopterin binding domain |
| 6 | PF18146.3 | 0.9 | 26 | 3350.5 | opposite-strand | Damage-inducible protein CinA KH domain |
| 7 | PF00154.23 | 0.9 | 26 | 2135.0 | opposite-strand | recA bacterial DNA recombination protein |
| 8 | PF08423.13 | 0.9 | 26 | 2135.0 | opposite-strand | Rad51 |
| 9 | PF12072.10 | 0.9 | 26 | 232.0 | opposite-strand | RNase Y N-terminal region |
| 10 | PF01966.24 | 0.9 | 26 | 232.0 | opposite-strand | HD domain |
| 11 | PF00013.31 | 0.9 | 26 | 232.0 | opposite-strand | KH domain |
| 12 | PF13277.8 | 1.0 | 29 | 165 | opposite-strand | YmdB-like protein |
| 13 | PF00149.30 | 1.0 | 29 | 165 | opposite-strand | Calcineurin-like phosphoesterase |
| 14 | PF01855.21 | 1.0 | 29 | 1092 | opposite-strand | Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg |
| 15 | PF01558.20 | 1.0 | 29 | 1092 | opposite-strand | Pyruvate ferredoxin/flavodoxin oxidoreductase |
| 16 | PF02775.23 | 1.0 | 29 | 2853 | opposite-strand | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain |
| 17 | PF12367.10 | 1.0 | 29 | 2853 | opposite-strand | Pyruvate ferredoxin oxidoreductase beta subunit C terminal |
| 18 | PF01910.19 | 0.66 | 19 | 4581 | opposite-strand | Thiamine-binding protein |
++ More..