Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01252 |
NCBI Accession ID | NC_017340.1 |
Organism | Staphylococcus aureus 04-02981 |
Left | 1346407 |
Right | 1346616 |
Strand | + |
Nucleotide Sequence | TTGTACAGATATGGAGATGAAAAAATGTCAGAATACAAGAAAAAGATAATTGAATTAATTGAAAGTAATTTAACAGGATATGAAATTTCTAAAAAAACTGGAGTTTCTCAATATGTACTTTCACAATTAAGACAGGGCAAACGCGAAGTAGATAATCTAACCCTGAATACAACAGAAAAATTATATGAATATGCCAATAAAGTTTTGTAA |
Sequence | LYRYGDEKMSEYKKKIIELIESNLTGYEISKKTGVSQYVLSQLRQGKREVDNLTLNTTEKLYEYANKVL |
Source of smORF | Protein-level |
Function | |
Pubmed ID | 30796087 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 69 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1247466 | 1247675 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
2 | 1923883 | 1924068 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
3 | 1354625 | 1354834 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
4 | 1346649 | 1346834 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
5 | 695006 | 695191 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
6 | 2082310 | 2082495 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
7 | 2337734 | 2337925 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
8 | 2498240 | 2498437 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
9 | 1356805 | 1356990 | - | NZ_CP065712.1 | Staphylococcus auricularis |
10 | 755725 | 755913 | - | NZ_CP018199.1 | Staphylococcus succinus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01510.27 | 0.67 | 4 | 569 | same-strand | N-acetylmuramoyl-L-alanine amidase |