Result : EXP01252

Protein Information

• Protein name: EXP01252
• NCBI Accession ID: NC_017340.1
• Organism: Staphylococcus aureus 04-02981
• Left: 1346407
• Right: 1346616
• Strand: +
• Nucleotide Sequence: TTGTACAGATATGGAGATGAAAAAATGTCAGAATACAAGAAAAAGATAATTGAATTAATTGAAAGTAATTTAACAGGATATGAAATTTCTAAAAAAACTGGAGTTTCTCAATATGTACTTTCACAATTAAGACAGGGCAAACGCGAAGTAGATAATCTAACCCTGAATACAACAGAAAAATTATATGAATATGCCAATAAAGTTTTGTAA
• Sequence: LYRYGDEKMSEYKKKIIELIESNLTGYEISKKTGVSQYVLSQLRQGKREVDNLTLNTTEKLYEYANKVL
• Source of smORF: Protein-level
• Pubmed ID: 30796087
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 69

Conservation Analysis

No. of Species: 6

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1247466	1247675	+	NC_007795.1	Staphylococcus aureus subsp. aureus NCTC 8325
2	1923883	1924068	-	NC_007795.1	Staphylococcus aureus subsp. aureus NCTC 8325
3	1354625	1354834	+	NZ_LR134304.1	Staphylococcus schweitzeri
4	1346649	1346834	+	NZ_LR134304.1	Staphylococcus schweitzeri
5	695006	695191	-	NC_022737.1	Staphylococcus pasteuri SP1
6	2082310	2082495	+	NC_022737.1	Staphylococcus pasteuri SP1
7	2337734	2337925	+	NZ_CP022096.2	Staphylococcus pettenkoferi
8	2498240	2498437	+	NZ_CP022096.2	Staphylococcus pettenkoferi
9	1356805	1356990	-	NZ_CP065712.1	Staphylococcus auricularis
10	755725	755913	-	NZ_CP018199.1	Staphylococcus succinus

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_007795.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF01510.27	0.67	4	569	same-strand	N-acetylmuramoyl-L-alanine amidase