Result : EXP01244
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01244 |
| NCBI Accession ID | NC_017340.1 |
| Organism | Staphylococcus aureus 04-02981 |
| Left | 1350366 |
| Right | 1350563 |
| Strand | + |
| Nucleotide Sequence | ATGGAACAAATTAAACTTAAAACTTTTACAGCTGAGACTTTAGAGTTATTAGAAAAAAACATTAATGCTTTTTTAAGTTCTGAAGAAGCTACAAATTTAAAATTAGTAAATATTACTATTAAAGAAATAGAAGAAAGAACATTCCCAAATAATGAAGAAGAATTCAATGCAATTTTAACTTTATCTGTGAATAAATAA |
| Sequence | MEQIKLKTFTAETLELLEKNINAFLSSEEATNLKLVNITIKEIEERTFPNNEEEFNAILTLSVNK |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1253703 | 1253900 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1358094 | 1358291 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 1288558 | 1288755 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 1575280 | 1575477 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 5 | 1800866 | 1801063 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 6 | 1637300 | 1637497 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 7 | 629994 | 630191 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 8 | 2465175 | 2465378 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 9 | 1517112 | 1517315 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 10 | 1184033 | 1184230 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 11 | 1603468 | 1603665 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 12 | 980393 | 980587 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13091.8 | 0.83 | 10 | 58.0 | same-strand | PLD-like domain |
| 2 | PF00614.24 | 0.83 | 10 | 58 | same-strand | Phospholipase D Active site motif |
| 3 | PF13396.8 | 0.75 | 9 | 58 | same-strand | Phospholipase D-nuclease N-terminal |
| 4 | PF00005.29 | 0.67 | 8 | 1708.5 | same-strand | ABC transporter |
++ More..