Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01244 |
NCBI Accession ID | NC_017340.1 |
Organism | Staphylococcus aureus 04-02981 |
Left | 1350366 |
Right | 1350563 |
Strand | + |
Nucleotide Sequence | ATGGAACAAATTAAACTTAAAACTTTTACAGCTGAGACTTTAGAGTTATTAGAAAAAAACATTAATGCTTTTTTAAGTTCTGAAGAAGCTACAAATTTAAAATTAGTAAATATTACTATTAAAGAAATAGAAGAAAGAACATTCCCAAATAATGAAGAAGAATTCAATGCAATTTTAACTTTATCTGTGAATAAATAA |
Sequence | MEQIKLKTFTAETLELLEKNINAFLSSEEATNLKLVNITIKEIEERTFPNNEEEFNAILTLSVNK |
Source of smORF | Protein-level |
Function | |
Pubmed ID | 30796087 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 65 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1253703 | 1253900 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
2 | 1358094 | 1358291 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
3 | 1288558 | 1288755 | + | NZ_LT906460.1 | Staphylococcus simiae |
4 | 1575280 | 1575477 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
5 | 1800866 | 1801063 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
6 | 1637300 | 1637497 | - | NZ_AP018587.1 | Staphylococcus caprae |
7 | 629994 | 630191 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
8 | 2465175 | 2465378 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
9 | 1517112 | 1517315 | - | NZ_LR134242.1 | Staphylococcus warneri |
10 | 1184033 | 1184230 | + | NZ_CP013114.1 | Staphylococcus equorum |
11 | 1603468 | 1603665 | - | NZ_CP008724.1 | Staphylococcus xylosus |
12 | 980393 | 980587 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13091.8 | 0.83 | 10 | 58.0 | same-strand | PLD-like domain |
2 | PF00614.24 | 0.83 | 10 | 58 | same-strand | Phospholipase D Active site motif |
3 | PF13396.8 | 0.75 | 9 | 58 | same-strand | Phospholipase D-nuclease N-terminal |
4 | PF00005.29 | 0.67 | 8 | 1708.5 | same-strand | ABC transporter |