ProsmORF-pred
Result : EXP01241
Protein Information
Information Type Description
Protein name EXP01241
NCBI Accession ID NC_017340.1
Organism Staphylococcus aureus 04-02981
Left 2257256
Right 2257516
Strand +
Nucleotide Sequence ATGGCAATGACAGTAAAGAAAGATAATAATGAAGTGCGTATTCAATGGAGAGTTGCTGATATCAAAATTCCTACAAGTGAAATTAAAAATATTACACAAGACCAAGATATTCATGCAGTTCCTAAATTAGACAGCAAAGATGTATCTAGAATCGGCTCAACGTTTGGTAAAACGAATCGCGTTATTATCGATACTGAAGACCACGAATACATTATTTATACTCAAAATGATCAAAAAGTTTACAATGAATTAACTAAATAA
Sequence MAMTVKKDNNEVRIQWRVADIKIPTSEIKNITQDQDIHAVPKLDSKDVSRIGSTFGKTNRVIIDTEDHEYIIYTQNDQKVYNELTK
Source of smORF Protein-level
Function
Pubmed ID 30796087
Domain
Functional Category Function not yet assigned
Uniprot ID Q6GEQ6
ORF Length (Amino Acid) 86
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 32
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2252508 2252768 + NC_007795.1 Staphylococcus aureus subsp. aureus NCTC 8325
2 2202711 2202971 + NZ_LR134304.1 Staphylococcus schweitzeri
3 2118520 2118780 + NZ_LT906460.1 Staphylococcus simiae
4 1739049 1739309 + NZ_CP013911.1 Staphylococcus haemolyticus
5 754232 754492 - NZ_LR134242.1 Staphylococcus warneri
6 674423 674683 + NC_022737.1 Staphylococcus pasteuri SP1
7 2303790 2304050 - NZ_CP014022.1 Staphylococcus lugdunensis
8 1021102 1021362 + NZ_CP022096.2 Staphylococcus pettenkoferi
9 769847 770107 - NZ_LR134089.1 Staphylococcus saprophyticus
10 826190 826450 - NZ_CP008724.1 Staphylococcus xylosus
11 802783 803043 - NZ_CP064056.1 Staphylococcus lloydii
12 1943738 1943998 + NZ_CP013114.1 Staphylococcus equorum
13 2727046 2727306 - NZ_CP018199.1 Staphylococcus succinus
14 1392494 1392754 + NZ_CP007601.1 Staphylococcus capitis subsp. capitis
15 645385 645645 - NZ_CP065712.1 Staphylococcus auricularis
16 830949 831209 - NZ_AP018587.1 Staphylococcus caprae
17 800208 800468 - NZ_CP035288.1 Staphylococcus epidermidis
18 166038 166298 + NZ_CP066042.1 Staphylococcus saccharolyticus
19 1679501 1679761 + NZ_LT906464.1 Staphylococcus muscae
20 944229 944486 - NZ_CP018776.1 Staphylococcus condimenti
21 2144530 2144787 + NZ_CP033460.1 Staphylococcus debuckii
22 748192 748452 - NZ_CP008747.1 Staphylococcus hyicus
23 1725376 1725636 + NZ_CP045927.1 Staphylococcus agnetis
24 572165 572425 + NZ_CP020773.1 Staphylococcus lutrae
25 106555 106812 + NZ_CP027770.1 Staphylococcus felis
26 1918653 1918913 + NC_014925.1 Staphylococcus pseudintermedius HKU10-03
27 293747 294013 - NZ_CP022046.2 Mammaliicoccus sciuri
28 373822 374082 - NZ_LT906462.1 Mammaliicoccus stepanovicii
29 1854574 1854837 + NZ_CP068061.1 Mammaliicoccus vitulinus
30 2077342 2077605 - NZ_CP065729.1 Macrococcus caseolyticus
31 395587 395850 - NZ_CP047361.1 Macrococcus canis
32 448977 449240 - NZ_CP054482.1 Macrococcus bohemicus
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_CP013911.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF17080.7 0.69 22 4362.0 opposite-strand Multidrug Resistance efflux pump
2 PF07690.18 0.88 28 2871.5 opposite-strand Major Facilitator Superfamily
3 PF03006.22 0.81 26 1981.0 opposite-strand Haemolysin-III related
4 PF04307.16 1.0 32 184.5 opposite-strand LexA-binding, inner membrane-associated putative hydrolase
5 PF07670.16 0.94 30 565.5 opposite-strand Nucleoside recognition
6 PF01032.20 0.78 25 2434.0 opposite-strand FecCD transport family
7 PF01497.20 0.72 23 4122 opposite-strand Periplasmic binding protein
8 PF03992.18 0.66 21 193 same-strand Antibiotic biosynthesis monooxygenase
++ More..