Result : EXP01241
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01241 |
| NCBI Accession ID | NC_017340.1 |
| Organism | Staphylococcus aureus 04-02981 |
| Left | 2257256 |
| Right | 2257516 |
| Strand | + |
| Nucleotide Sequence | ATGGCAATGACAGTAAAGAAAGATAATAATGAAGTGCGTATTCAATGGAGAGTTGCTGATATCAAAATTCCTACAAGTGAAATTAAAAATATTACACAAGACCAAGATATTCATGCAGTTCCTAAATTAGACAGCAAAGATGTATCTAGAATCGGCTCAACGTTTGGTAAAACGAATCGCGTTATTATCGATACTGAAGACCACGAATACATTATTTATACTCAAAATGATCAAAAAGTTTACAATGAATTAACTAAATAA |
| Sequence | MAMTVKKDNNEVRIQWRVADIKIPTSEIKNITQDQDIHAVPKLDSKDVSRIGSTFGKTNRVIIDTEDHEYIIYTQNDQKVYNELTK |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | Q6GEQ6 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 32
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2252508 | 2252768 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 2202711 | 2202971 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 2118520 | 2118780 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 1739049 | 1739309 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 5 | 754232 | 754492 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 6 | 674423 | 674683 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 7 | 2303790 | 2304050 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 8 | 1021102 | 1021362 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 9 | 769847 | 770107 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 10 | 826190 | 826450 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 11 | 802783 | 803043 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 12 | 1943738 | 1943998 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 13 | 2727046 | 2727306 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 14 | 1392494 | 1392754 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 15 | 645385 | 645645 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 16 | 830949 | 831209 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 17 | 800208 | 800468 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 18 | 166038 | 166298 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 19 | 1679501 | 1679761 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 20 | 944229 | 944486 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 21 | 2144530 | 2144787 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 22 | 748192 | 748452 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 23 | 1725376 | 1725636 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 24 | 572165 | 572425 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 25 | 106555 | 106812 | + | NZ_CP027770.1 | Staphylococcus felis |
| 26 | 1918653 | 1918913 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 27 | 293747 | 294013 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 28 | 373822 | 374082 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 29 | 1854574 | 1854837 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 30 | 2077342 | 2077605 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 31 | 395587 | 395850 | - | NZ_CP047361.1 | Macrococcus canis |
| 32 | 448977 | 449240 | - | NZ_CP054482.1 | Macrococcus bohemicus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013911.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17080.7 | 0.69 | 22 | 4362.0 | opposite-strand | Multidrug Resistance efflux pump |
| 2 | PF07690.18 | 0.88 | 28 | 2871.5 | opposite-strand | Major Facilitator Superfamily |
| 3 | PF03006.22 | 0.81 | 26 | 1981.0 | opposite-strand | Haemolysin-III related |
| 4 | PF04307.16 | 1.0 | 32 | 184.5 | opposite-strand | LexA-binding, inner membrane-associated putative hydrolase |
| 5 | PF07670.16 | 0.94 | 30 | 565.5 | opposite-strand | Nucleoside recognition |
| 6 | PF01032.20 | 0.78 | 25 | 2434.0 | opposite-strand | FecCD transport family |
| 7 | PF01497.20 | 0.72 | 23 | 4122 | opposite-strand | Periplasmic binding protein |
| 8 | PF03992.18 | 0.66 | 21 | 193 | same-strand | Antibiotic biosynthesis monooxygenase |
++ More..