Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01235 |
NCBI Accession ID | NC_017340.1 |
Organism | Staphylococcus aureus 04-02981 |
Left | 483735 |
Right | 484004 |
Strand | - |
Nucleotide Sequence | ATGGCAAAACGTTCCAAATCACAACGTTTATCAAGTTTACTAAATGTCGCAGGTTTCATAGTCGACGGCTACAATGGCTATAAATATCATGCTAAAAATAAAAAATTAGTATATCTTTCATTAGGTTTAAGCACTGTAGGAACCGTGTTAGACTTTTACATTTCAATTAAGTCACCACGTAAGTTCAAAAAAGCAGTGGCAGTTGTTACTTTAATAACAAACGGTGCTAGATTATTTACAAGCATTCGCAAAGTAAAGCATGAATACTAA |
Sequence | MAKRSKSQRLSSLLNVAGFIVDGYNGYKYHAKNKKLVYLSLGLSTVGTVLDFYISIKSPRKFKKAVAVVTLITNGARLFTSIRKVKHEY |
Source of smORF | Protein-level |
Function | |
Pubmed ID | 30796087 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 89 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 428798 | 429067 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
2 | 440624 | 440893 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
3 | 445412 | 445681 | - | NZ_LT906460.1 | Staphylococcus simiae |
4 | 2492840 | 2493112 | + | NZ_AP018587.1 | Staphylococcus caprae |
5 | 2253678 | 2253947 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
6 | 2367643 | 2367921 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
7 | 778380 | 778658 | + | NZ_CP033732.1 | Staphylococcus hominis |
8 | 140701 | 140979 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
9 | 2285554 | 2285823 | + | NZ_LR134242.1 | Staphylococcus warneri |
10 | 1643720 | 1643989 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
11 | 1316071 | 1316340 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00005.29 | 0.64 | 7 | 3409.0 | opposite-strand | ABC transporter |
2 | PF09383.12 | 0.64 | 7 | 3254 | opposite-strand | NIL domain |
3 | PF00528.24 | 0.64 | 7 | 2595 | opposite-strand | Binding-protein-dependent transport system inner membrane component |
4 | PF03180.16 | 0.64 | 7 | 1721 | opposite-strand | NlpA lipoprotein |
5 | PF01476.22 | 0.91 | 10 | 218.0 | opposite-strand | LysM domain |
6 | PF05257.18 | 0.91 | 10 | 218.0 | opposite-strand | CHAP domain |
7 | PF00293.30 | 1.0 | 11 | 157 | opposite-strand | NUDIX domain |
8 | PF07907.13 | 1.0 | 11 | 1375.0 | same-strand | YibE/F-like protein |
9 | PF00126.29 | 1.0 | 11 | 3135 | same-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
10 | PF03466.22 | 0.91 | 10 | 3149.0 | same-strand | LysR substrate binding domain |