Result : EXP01234
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01234 |
| NCBI Accession ID | NC_000908.2 |
| Organism | Mycoplasma genitalium G37 |
| Left | 315467 |
| Right | 315697 |
| Strand | + |
| Nucleotide Sequence | ATGGCAAAAGATAAAAAAAATAAGGTTGATGGAACAGAGCAATCAGTTGATCTATTTGAACGTACAAAACTTGAAGATACACAAGTTTTAAATGAAGTTGAACTTGATGATATTAAAAAGATAACAGAGCTTAGAAAAGAACTTGAACATACTTTTGAACCACAAACAAGAATGCAAATTAAGCGTGAAATTAAAGAAATAGAACGCAAAATGAAACGTTCTAGTCGCTAA |
| Sequence | MAKDKKNKVDGTEQSVDLFERTKLEDTQVLNEVELDDIKKITELRKELEHTFEPQTRMQIKREIKEIERKMKRSSR |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | Q9EXD3 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 315467 | 315697 | + | NC_000908.2 | Mycoplasma genitalium G37 |
| 2 | 451723 | 451947 | + | NZ_CP010546.1 | Mycoplasma pneumoniae FH |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000908.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07733.14 | 1.0 | 2 | 613.0 | same-strand | Bacterial DNA polymerase III alpha NTPase domain |
| 2 | PF01367.22 | 1.0 | 2 | 2846.5 | same-strand | 5'-3' exonuclease, C-terminal SAM fold |
++ More..