Result : B2KEU6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L33 |
| NCBI Accession ID | CP001055.1 |
| Organism | Elusimicrobium minutum (strain Pei191) |
| Left | 1588911 |
| Right | 1589075 |
| Strand | - |
| Nucleotide Sequence | ATGGCCAGCAAAGAAAGACAAACTATATTATTAGCCTGCACGGAATGCAAAAATAAAAACTATTATTATGCGCGCGGCAAAAAGAAAGAATTTAAACTTGAACTCAACAAATTTTGCAAAGCTTGCGGCAAATCAACAAAACATAAAGAAGGCAAAGCTAACTAA |
| Sequence | MASKERQTILLACTECKNKNYYYARGKKKEFKLELNKFCKACGKSTKHKEGKAN |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00383. Profile Description: Ribosomal protein L33. This model describes bacterial ribosomal protein L33 and its chloroplast and mitochondrial equivalents. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 19270133 |
| Domain | CDD:412348 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B2KEU6 |
| ORF Length (Amino Acid) | 54 |
++ More..
| Conservation Analysis |
No. of Species: 140
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1588911 | 1589075 | - | NC_010644.1 | Elusimicrobium minutum Pei191 |
| 2 | 962974 | 963126 | - | NZ_CP009498.1 | Endomicrobium proavitum |
| 3 | 2261640 | 2261789 | - | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 4 | 643666 | 643809 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 5 | 1275033 | 1275182 | - | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 6 | 295988 | 296137 | + | NZ_CP045007.1 | Latilactobacillus graminis |
| 7 | 164829 | 164990 | + | NZ_CP010899.1 | Spiroplasma kunkelii CR2-3x |
| 8 | 1212724 | 1212891 | - | NZ_CP062938.1 | Bifidobacterium eulemuris |
| 9 | 1648695 | 1648862 | + | NZ_CP062948.1 | Bifidobacterium lemurum |
| 10 | 219821 | 219982 | + | NZ_CP013197.1 | Spiroplasma citri |
| 11 | 685161 | 685322 | - | NZ_CP031088.1 | Spiroplasma phoeniceum P40 |
| 12 | 241871 | 242020 | - | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 13 | 531193 | 531342 | - | NZ_CP046037.1 | Latilactobacillus sakei |
| 14 | 1800956 | 1801105 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 15 | 6265362 | 6265526 | - | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 16 | 629809 | 629961 | - | NZ_CP012333.1 | Labilithrix luteola |
| 17 | 63163 | 63327 | + | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 18 | 1980872 | 1981036 | + | NZ_CP038452.1 | Thermus caldilimi |
| 19 | 3168106 | 3168255 | - | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 20 | 4437819 | 4437983 | + | NC_020126.1 | Myxococcus stipitatus DSM 14675 |
| 21 | 1676049 | 1676198 | - | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 22 | 69781 | 69930 | + | NZ_CP027228.1 | Mogibacterium diversum |
| 23 | 2111951 | 2112085 | - | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 24 | 1257466 | 1257630 | + | NZ_CP016312.1 | Thermus brockianus |
| 25 | 604064 | 604213 | - | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 26 | 420686 | 420850 | + | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 27 | 398649 | 398798 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 28 | 1980079 | 1980228 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 29 | 2030760 | 2030909 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 30 | 2310388 | 2310537 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 31 | 38606 | 38755 | + | NZ_CP036259.1 | Sporomusa termitida |
| 32 | 1474548 | 1474697 | - | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 33 | 1308524 | 1308682 | + | NZ_CP007028.1 | Thermocrinis ruber |
| 34 | 228677 | 228814 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 35 | 460964 | 461101 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 36 | 471072 | 471209 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 37 | 679065 | 679214 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 38 | 3293319 | 3293483 | - | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 39 | 640579 | 640731 | + | NZ_AP022873.1 | Dissulfurispira thermophila |
| 40 | 989400 | 989534 | - | NZ_CP009761.1 | Parvimonas micra |
| 41 | 873030 | 873179 | + | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 42 | 1123930 | 1124082 | + | NC_012440.1 | Persephonella marina EX-H1 |
| 43 | 1358160 | 1358312 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 44 | 338263 | 338412 | - | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 45 | 1640104 | 1640253 | - | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 46 | 2224201 | 2224350 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 47 | 2623848 | 2623997 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 48 | 3975715 | 3975864 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 49 | 2198053 | 2198202 | + | NZ_LT828648.1 | Nitrospira japonica |
| 50 | 1057684 | 1057833 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 51 | 1059247 | 1059411 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 52 | 390141 | 390290 | + | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 53 | 1378171 | 1378320 | + | NC_010814.1 | Geobacter lovleyi SZ |
| 54 | 2342340 | 2342504 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 55 | 1454360 | 1454515 | - | NZ_CP034726.1 | Acetilactobacillus jinshanensis |
| 56 | 2513119 | 2513268 | - | NZ_CP017237.1 | Moorella thermoacetica |
| 57 | 1412753 | 1412902 | - | NZ_CP029256.1 | Christensenella minuta |
| 58 | 216907 | 217056 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 59 | 165005 | 165154 | + | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 60 | 3704768 | 3704920 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 61 | 1081283 | 1081435 | + | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 62 | 3368337 | 3368486 | - | NZ_CP040924.1 | Clostridium thermarum |
| 63 | 1399354 | 1399518 | - | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 64 | 1137011 | 1137175 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 65 | 1020474 | 1020638 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 66 | 1231775 | 1231939 | + | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 67 | 1623368 | 1623532 | - | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 68 | 1350105 | 1350269 | + | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 69 | 1621656 | 1621820 | - | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 70 | 1385907 | 1386056 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 71 | 6055338 | 6055487 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 72 | 2283383 | 2283532 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 73 | 1251976 | 1252125 | + | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 74 | 353647 | 353796 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 75 | 1063653 | 1063802 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 76 | 120580 | 120729 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 77 | 2431684 | 2431833 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 78 | 1191170 | 1191319 | + | NZ_CP061799.1 | Desulfonema limicola |
| 79 | 445156 | 445305 | + | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 80 | 3554010 | 3554159 | - | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 81 | 1071014 | 1071166 | - | NC_017096.1 | Caldisericum exile AZM16c01 |
| 82 | 2188463 | 2188612 | - | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 83 | 1669057 | 1669206 | + | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 84 | 1130025 | 1130174 | + | NZ_CP011801.1 | Nitrospira moscoviensis |
| 85 | 421510 | 421659 | + | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 86 | 445302 | 445451 | + | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 87 | 2394223 | 2394372 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 88 | 177470 | 177619 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 89 | 1675146 | 1675295 | + | NZ_CP029462.1 | Megasphaera stantonii |
| 90 | 1861026 | 1861175 | - | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 91 | 2918756 | 2918905 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 92 | 221421 | 221570 | + | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 93 | 337420 | 337569 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 94 | 125626 | 125775 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 95 | 528847 | 528996 | - | NZ_CP009240.1 | Megasphaera elsdenii 14-14 |
| 96 | 235019 | 235156 | + | NZ_CP016786.1 | Clostridium isatidis |
| 97 | 262442 | 262591 | + | NZ_CP014204.2 | Clostridium baratii |
| 98 | 2171580 | 2171729 | + | NZ_LT996885.1 | Dialister massiliensis |
| 99 | 631764 | 631913 | + | NZ_CP014176.1 | Clostridium argentinense |
| 100 | 1273704 | 1273853 | - | NZ_LR134524.1 | Peptoniphilus harei |
| 101 | 642612 | 642761 | + | NZ_CP011856.1 | Spiroplasma eriocheiris |
| 102 | 286357 | 286506 | + | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 103 | 222665 | 222814 | + | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 104 | 4518751 | 4518900 | - | NC_014393.1 | Clostridium cellulovorans 743B |
| 105 | 195493 | 195645 | + | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 106 | 337980 | 338129 | + | NZ_LT635480.1 | Ndongobacter massiliensis |
| 107 | 53596 | 53745 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 108 | 607392 | 607538 | - | NZ_LR214938.2 | Mycoplasma salivarium |
| 109 | 599352 | 599498 | - | NZ_CP029295.1 | Mycoplasma phocidae |
| 110 | 545118 | 545270 | - | NZ_LR215042.1 | Mycoplasmopsis meleagridis |
| 111 | 2681509 | 2681658 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 112 | 2714930 | 2715103 | - | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 113 | 705338 | 705487 | + | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 114 | 358381 | 358533 | - | NZ_CP028102.1 | Fusobacterium mortiferum ATCC 9817 |
| 115 | 1182843 | 1182995 | - | NZ_CP028105.1 | Fusobacterium ulcerans |
| 116 | 2524456 | 2524632 | - | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 117 | 881499 | 881651 | - | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
| 118 | 1014681 | 1014821 | + | NZ_CP024161.1 | Mycoplasma dispar |
| 119 | 4542731 | 4542880 | - | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 120 | 5117570 | 5117719 | + | NZ_CP042806.1 | Terriglobus albidus |
| 121 | 4032702 | 4032851 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
| 122 | 836631 | 836780 | + | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 123 | 3340096 | 3340245 | - | NC_014624.2 | Eubacterium callanderi |
| 124 | 4029781 | 4029930 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 125 | 1843534 | 1843683 | + | NZ_CP019962.1 | Eubacterium limosum |
| 126 | 250206 | 250355 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 127 | 2992597 | 2992746 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 128 | 3188660 | 3188809 | - | NZ_CP030280.1 | Blautia argi |
| 129 | 1256805 | 1256954 | + | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 130 | 478334 | 478471 | + | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 131 | 206607 | 206765 | + | NC_016638.1 | Mycoplasma haemocanis str. Illinois |
| 132 | 526529 | 526681 | + | NZ_LR215041.1 | Mycoplasmopsis columbina |
| 133 | 1584979 | 1585128 | - | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 134 | 15486 | 15632 | + | NZ_CP030103.1 | Mycoplasma cloacale |
| 135 | 2115299 | 2115448 | - | NZ_HF545616.1 | Ruminococcus bicirculans |
| 136 | 2895251 | 2895400 | - | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 137 | 595639 | 595791 | - | NC_002771.1 | Mycoplasmopsis pulmonis UAB CTIP |
| 138 | 2191504 | 2191653 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 139 | 1501184 | 1501318 | - | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 140 | 1367818 | 1367958 | - | NC_015318.1 | Hippea maritima DSM 10411 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015519.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00687.23 | 0.89 | 125 | 1418 | same-strand | Ribosomal protein L1p/L10e family |
| 2 | PF03946.16 | 0.9 | 126 | 942.0 | same-strand | Ribosomal protein L11, N-terminal domain |
| 3 | PF00298.21 | 0.9 | 126 | 942.0 | same-strand | Ribosomal protein L11, RNA binding domain |
| 4 | PF02357.21 | 0.87 | 122 | 322.0 | same-strand | Transcription termination factor nusG |
| 5 | PF00467.31 | 0.79 | 110 | 328.0 | same-strand | KOW motif |
| 6 | PF00584.22 | 0.85 | 119 | 52 | same-strand | SecE/Sec61-gamma subunits of protein translocation complex |
| 7 | PF00466.22 | 0.77 | 108 | 2314.5 | same-strand | Ribosomal protein L10 |
++ More..