Result : EXP01233
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01233 |
| NCBI Accession ID | NZ_CP009472.1 |
| Organism | Lactococcus lactis strain AI06 |
| Left | 2080528 |
| Right | 2080758 |
| Strand | + |
| Nucleotide Sequence | ATGCGTACAACAAAAGCCACTGAAGAAATCGAAAAAGCTATTATTCACCTGAAGAAAGCAAAACGAGAAATTAGTAATTATACTTTTGAATACAATGTTCAAAACTTGATTCAGTTAGATAAGACAATTAAGCAGTTGGAAAATATCAAAACTGGAATCAATGCAGATAGTTTTTCTGTTGAAGGAGTCAAATCTACCGGTGAAATTGAAGGCGCACGTCTTTCAAGATAA |
| Sequence | MRTTKATEEIEKAIIHLKKAKREISNYTFEYNVQNLIQLDKTIKQLENIKTGINADSFSVEGVKSTGEIEGARLSR |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1864054 | 1864284 | + | NZ_CP070872.1 | Lactococcus taiwanensis |
| 2 | 2094368 | 2094598 | + | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 3 | 1692009 | 1692239 | + | NZ_CP032627.1 | Lactococcus allomyrinae |
| 4 | 662666 | 662908 | - | NZ_CP065637.1 | Lactococcus garvieae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP032627.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00709.23 | 0.75 | 3 | 3883 | opposite-strand | Adenylosuccinate synthetase |
| 2 | PF01430.21 | 0.75 | 3 | 2048 | same-strand | Hsp33 protein |
| 3 | PF01207.19 | 1.0 | 4 | 93.5 | same-strand | Dihydrouridine synthase (Dus) |
| 4 | PF02588.17 | 1.0 | 4 | 1150 | opposite-strand | Uncharacterised 5xTM membrane BCR, YitT family COG1284 |
| 5 | PF10035.11 | 1.0 | 4 | 1150 | opposite-strand | Uncharacterized protein conserved in bacteria (DUF2179) |
| 6 | PF00152.22 | 0.75 | 3 | 2963 | opposite-strand | tRNA synthetases class II (D, K and N) |
| 7 | PF02938.16 | 0.75 | 3 | 2963 | opposite-strand | GAD domain |
| 8 | PF01336.27 | 0.75 | 3 | 2963 | opposite-strand | OB-fold nucleic acid binding domain |
++ More..