Result : EXP01230
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01230 |
| NCBI Accession ID | NC_017340.1 |
| Organism | Staphylococcus aureus 04-02981 |
| Left | 1977071 |
| Right | 1977286 |
| Strand | - |
| Nucleotide Sequence | GTGAACATTGTGGCTATGACAAATGAAGAGAAAGTATTAGCTATTAGAGAGAAGTTAAATATTGTTAATCAAGGATTATTAGATCCTGAAAAATATAAAAATGCAAATGAAGAAGAATTAACAGATATATATGATTTTGTTCAATCAAGAGAAAGATTGTCGCCAAGTGAAGTGACAGCTATTGCTGACGCTTTAGGACAATTGCGACACGACTAG |
| Sequence | VNIVAMTNEEKVLAIREKLNIVNQGLLDPEKYKNANEEELTDIYDFVQSRERLSPSEVTAIADALGQLRHD |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl23968. Profile Description: Protein of unknown function (DUF1128). This family consists of several short, hypothetical bacterial proteins of unknown function. |
| Pubmed ID | 30796087 |
| Domain | CDD:420123 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | Q8CRV4 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 19
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1970258 | 1970473 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1888073 | 1888288 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 3 | 1970603 | 1970803 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 4 | 1059257 | 1059472 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 5 | 1188323 | 1188538 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 6 | 2322233 | 2322448 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 7 | 966931 | 967134 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 8 | 461667 | 461870 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 9 | 1535558 | 1535743 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 10 | 1732661 | 1732867 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 11 | 842132 | 842335 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 12 | 184624 | 184836 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 13 | 2519982 | 2520188 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 14 | 1036665 | 1036877 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 15 | 1741601 | 1741813 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 16 | 971570 | 971782 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 17 | 2377996 | 2378181 | - | NZ_CP027770.1 | Staphylococcus felis |
| 18 | 1165343 | 1165558 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 19 | 1930464 | 1930649 | - | NZ_CP033460.1 | Staphylococcus debuckii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT906460.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08756.12 | 0.95 | 18 | 2114.5 | opposite-strand | YfkB-like domain |
| 2 | PF04055.23 | 0.79 | 15 | 2131 | opposite-strand | Radical SAM superfamily |
| 3 | PF13394.8 | 0.95 | 18 | 2114.5 | opposite-strand | 4Fe-4S single cluster domain |
| 4 | PF03061.24 | 1.0 | 19 | 1329 | same-strand | Thioesterase superfamily |
| 5 | PF02073.17 | 1.0 | 19 | 14 | same-strand | Thermophilic metalloprotease (M29) |
| 6 | PF01451.23 | 1.0 | 19 | 132 | opposite-strand | Low molecular weight phosphotyrosine protein phosphatase |
| 7 | PF03631.17 | 1.0 | 19 | 1156 | opposite-strand | Virulence factor BrkB |
| 8 | PF00072.26 | 1.0 | 19 | 2542 | same-strand | Response regulator receiver domain |
| 9 | PF00196.21 | 1.0 | 19 | 2542 | same-strand | Bacterial regulatory proteins, luxR family |
| 10 | PF08281.14 | 1.0 | 19 | 2542 | same-strand | Sigma-70, region 4 |
| 11 | PF07730.15 | 0.79 | 15 | 3120 | same-strand | Histidine kinase |
| 12 | PF02518.28 | 0.79 | 15 | 3120 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 13 | PF01965.26 | 0.84 | 16 | 3682.0 | same-strand | DJ-1/PfpI family |
++ More..