| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01229 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli K12 |
| Left | 4112967 |
| Right | 4113266 |
| Strand | + |
| Nucleotide Sequence | ATGAAAGATGTCGTAGATAAATGCAGTACTAAAGGATGTGCGATTGATATCGGTACGGTGATTGATAACGACAACTGTACCAGTAAGTTTTCGCGCTTTTTTGCCACCCGCGAAGAAGCAGAGTCTTTTATGACCAAACTGAAAGAGCTTGCCGCCGCTACATCCTCTGCAGATGAAGGGGCCAGCGTGGCCTATAAGATTAAGGATCTGGAGGGGCAAGTTGAGCTTGATGCGGCCTTCACTTTCTCATGCCAGGCCGAGATGATTATTTTTGAGTTATCACTGCGTTCGTTAGCTTGA |
| Sequence | MKDVVDKCSTKGCAIDIGTVIDNDNCTSKFSRFFATREEAESFMTKLKELAAATSSADEGASVAYKIKDLEGQVELDAAFTFSCQAEMIIFELSLRSLA |
| Source of smORF | Protein-level |
| Function | cytosol [GO:0005829] The ORF matches to the profile of cl11449. Profile Description: Protein of unknown function (DUF406). These small proteins are approximately 100 amino acids in length and appear to be found only in gamma proteobacteria. The function of this protein family is unknown. [Hypothetical proteins, Conserved] |
| Pubmed ID | 30796087 |
| Domain | CDD:416274 |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | P32162 |
| ORF Length (Amino Acid) | 99 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4112967 | 4113266 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 4127949 | 4128248 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 4913053 | 4913352 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 33444 | 33767 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 4081060 | 4081359 | + | NZ_AP014857.1 | Escherichia albertii |
| 6 | 139099 | 139398 | + | NZ_LR134340.1 | Escherichia marmotae |
| 7 | 3050666 | 3050965 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 8 | 2410929 | 2411222 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 9 | 1875767 | 1876063 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
| 10 | 3549865 | 3550161 | - | NZ_CP023706.1 | Edwardsiella tarda |
| 11 | 3192326 | 3192625 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 12 | 3795058 | 3795354 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 13 | 3136618 | 3136917 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 14 | 2435343 | 2435642 | + | NZ_CP054254.1 | Klebsiella variicola |
| 15 | 2351880 | 2352179 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 16 | 2887665 | 2887964 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00175.23 | 0.6 | 9 | 460.0 | opposite-strand | Oxidoreductase NAD-binding domain |