Result : EXP01228
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01228 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli K12 |
| Left | 3250077 |
| Right | 3250376 |
| Strand | + |
| Nucleotide Sequence | GTGAGCAGTAAAGTCGAACGTGAACGACGTAAGGCGCAACTGCTTAGCCAGATCCAGCAACAACGGCTGGATCTTTCCGCCAGTCGTCGTGAATGGCTGGAGACAACAGGCGCTTACGATCGTCGCTGGAATATGCTGCTAAGTCTGCGCTCCTGGGCGCTGGTTGGCAGTAGCGTGATGGCGATCTGGACGATTCGCCATCCTAATATGCTGGTCCGCTGGGCCAGACGCGGTTTTGGCGTATGGAGCGCCTGGCGTCTGGTTAAAACGACCCTCAAGCAGCAACAGCTTCGCGGTTAA |
| Sequence | VSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVMAIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLRG |
| Source of smORF | Protein-level |
| Function | cytosol [GO:0005829] The ORF matches to the profile of pfam13997. Profile Description: YqjK-like protein. The YqjK-like protein family includes the E. coli YqjK protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 100 amino acids in length. There is a single completely conserved residue R that may be functionally important. |
| Pubmed ID | 30796087 |
| Domain | CDD:404817 |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | Q47710 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 88
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3250077 | 3250376 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 3989837 | 3990136 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 556215 | 556514 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 3242040 | 3242339 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 3764521 | 3764820 | + | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 3470799 | 3471098 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 7 | 3239729 | 3240028 | + | NZ_AP014857.1 | Escherichia albertii |
| 8 | 3397508 | 3397807 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 9 | 1259145 | 1259444 | + | NZ_CP053416.1 | Salmonella bongori |
| 10 | 4163697 | 4163996 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 11 | 1832184 | 1832480 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 12 | 4258088 | 4258384 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 13 | 4032200 | 4032499 | - | NZ_CP038469.1 | Citrobacter tructae |
| 14 | 2802609 | 2802905 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 15 | 4100045 | 4100341 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 16 | 4306448 | 4306744 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 17 | 5038462 | 5038746 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 18 | 1855037 | 1855330 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 19 | 568441 | 568731 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 20 | 581234 | 581533 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 21 | 4205311 | 4205607 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 22 | 5255521 | 5255814 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 23 | 4085869 | 4086165 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 24 | 2530120 | 2530410 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 25 | 4277821 | 4278111 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 26 | 3015694 | 3015993 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 27 | 3205800 | 3206096 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 28 | 2059336 | 2059635 | + | NZ_CP033744.1 | Citrobacter freundii |
| 29 | 4450424 | 4450720 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 30 | 3514083 | 3514373 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 31 | 4015698 | 4015994 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 32 | 518070 | 518327 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 33 | 2911671 | 2911961 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 34 | 512037 | 512327 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 35 | 3646128 | 3646418 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 36 | 5311716 | 5312006 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 37 | 520730 | 520987 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 38 | 4716311 | 4716601 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 39 | 4060155 | 4060451 | + | NC_015968.1 | Enterobacter soli |
| 40 | 1141641 | 1141931 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 41 | 610164 | 610454 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 42 | 633728 | 634000 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 43 | 3707408 | 3707698 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 44 | 3912038 | 3912328 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 45 | 269590 | 269889 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 46 | 2291120 | 2291374 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 47 | 4060774 | 4061052 | + | NZ_LR134201.1 | Cedecea lapagei |
| 48 | 4344905 | 4345195 | + | NZ_CP023525.1 | Cedecea neteri |
| 49 | 3993168 | 3993449 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 50 | 643853 | 644134 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 51 | 598012 | 598308 | - | NZ_CP050508.1 | Raoultella terrigena |
| 52 | 627351 | 627647 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 53 | 1095020 | 1095316 | + | NZ_CP026047.1 | Raoultella planticola |
| 54 | 587336 | 587632 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 55 | 3700345 | 3700593 | + | NZ_CP061511.1 | Mixta calida |
| 56 | 594053 | 594349 | - | NZ_CP054254.1 | Klebsiella variicola |
| 57 | 734889 | 735188 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 58 | 3065052 | 3065339 | + | NZ_CP028271.1 | Mixta intestinalis |
| 59 | 3922198 | 3922446 | + | NZ_CP026377.1 | Mixta gaviniae |
| 60 | 579636 | 579932 | - | NZ_CP041247.1 | Raoultella electrica |
| 61 | 558683 | 558937 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 62 | 681865 | 682122 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 63 | 2169238 | 2169525 | - | NZ_CP019706.1 | Pantoea alhagi |
| 64 | 3276227 | 3276523 | + | NZ_LN907827.1 | Erwinia gerundensis |
| 65 | 612358 | 612642 | - | NC_017554.1 | Pantoea ananatis PA13 |
| 66 | 3237634 | 3237879 | + | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 67 | 3477718 | 3478002 | + | NZ_CP034148.1 | Pantoea agglomerans |
| 68 | 2284287 | 2284535 | + | NZ_CP049115.1 | Pantoea stewartii |
| 69 | 599854 | 600135 | - | NC_014306.1 | Erwinia billingiae Eb661 |
| 70 | 3193386 | 3193667 | + | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 71 | 593581 | 593865 | - | NZ_CP045720.1 | Pantoea eucalypti |
| 72 | 590188 | 590484 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 73 | 603635 | 603919 | - | NZ_CP038853.1 | Pantoea vagans |
| 74 | 3351381 | 3351662 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 75 | 4685987 | 4686283 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 76 | 689993 | 690283 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 77 | 4281046 | 4281336 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
| 78 | 4579703 | 4579990 | + | NZ_LT906479.1 | Serratia ficaria |
| 79 | 4677518 | 4677805 | + | NZ_CP048784.1 | Serratia liquefaciens |
| 80 | 568898 | 569185 | - | NZ_CP071320.1 | Serratia ureilytica |
| 81 | 4622549 | 4622836 | + | NZ_CP038662.1 | Serratia nematodiphila |
| 82 | 578550 | 578798 | - | NZ_CP011118.1 | Yersinia enterocolitica |
| 83 | 4789809 | 4790096 | + | NC_015567.1 | Serratia plymuthica AS9 |
| 84 | 4732485 | 4732733 | + | NZ_LR134494.1 | Serratia quinivorans |
| 85 | 634912 | 635202 | - | NZ_CP034938.1 | Pectobacterium odoriferum |
| 86 | 1062181 | 1062468 | + | NZ_CP011254.1 | Serratia fonticola |
| 87 | 990816 | 991106 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
| 88 | 4213527 | 4213817 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 89 | 4468039 | 4468329 | - | NZ_CP017482.1 | Pectobacterium polaris |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134340.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09335.13 | 1.0 | 88 | 1650 | same-strand | SNARE associated Golgi protein |
| 2 | PF13721.8 | 0.94 | 83 | 1261.5 | same-strand | SecD export protein N-terminal TM region |
| 3 | PF06476.14 | 1.0 | 88 | 742 | same-strand | Protein of unknown function (DUF1090) |
| 4 | PF19029.2 | 1.0 | 88 | 398 | same-strand | DUF883 C-terminal glycine zipper region |
| 5 | PF05957.15 | 1.0 | 88 | 398 | same-strand | DUF883 N-terminal domain |
| 6 | PF07332.13 | 1.0 | 88 | -3 | same-strand | Putative Actinobacterial Holin-X, holin superfamily III |
| 7 | PF07681.14 | 0.97 | 85 | 225.5 | same-strand | DoxX |
| 8 | PF13409.8 | 0.93 | 82 | 714 | same-strand | Glutathione S-transferase, N-terminal domain |
| 9 | PF13410.8 | 0.68 | 60 | 710 | same-strand | Glutathione S-transferase, C-terminal domain |
| 10 | PF05656.16 | 0.64 | 56 | 1823.0 | same-strand | Protein of unknown function (DUF805) |
| 11 | PF03466.22 | 0.82 | 72 | 2178 | opposite-strand | LysR substrate binding domain |
| 12 | PF00126.29 | 0.82 | 72 | 2178 | opposite-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
| 13 | PF02678.18 | 0.75 | 66 | 3177.5 | same-strand | Pirin |
| 14 | PF17954.3 | 0.76 | 67 | 3176 | same-strand | Quercetinase C-terminal cupin domain |
++ More..