| Protein name |
EXP01224 |
| NCBI Accession ID |
NZ_CP001668.1 |
| Organism |
Mycoplasma mycoides subsp. capri LC str. 95010 |
| Left |
893772 |
| Right |
894044 |
| Strand |
+ |
| Nucleotide Sequence |
ATGAAAAAAGTAAATGTCAATATTAAAATGGATCCTGAAATTAAAAAACAGGCTAGTTTATTATTTAAAGAATTTGGTATGACCATGTCTTCTGCTATTAATCTATTTGTGAAAACTGCTGTTGAACAAAACGACATTCCATTTGAATATAATAGAGAGATAACTAACAAAGAAACTTTAGAAGCCTTTAAAGAAGGTGAACGTCTTTTAGCTGATAAAAACGCAAAACGTTACTCAAGTTTTAAAGAAATATTAGATTCATTAGATAAATAA |
| Sequence |
MKKVNVNIKMDPEIKKQASLLFKEFGMTMSSAINLFVKTAVEQNDIPFEYNREITNKETLEAFKEGERLLADKNAKRYSSFKEILDSLDK |
| Source of smORF |
Protein-level |
| Function |
The ORF matches to the profile of cl01171. Profile Description: RelB antitoxin. Plasmids may be maintained stably in bacterial populations through the action of addiction modules, in which a toxin and antidote are encoded in a cassette on the plasmid. In any daughter cell that lacks the plasmid, the toxin persists and is lethal after the antidote protein is depleted. Toxin/antitoxin pairs are also found on main chromosomes, and likely represent selfish DNA. Sequences in the seed for this alignment all were found adjacent to toxin genes. The resulting model appears to describe a narrower set of proteins than pfam04221, although many in the scope of this model are not obviously paired with toxin proteins. Several toxin/antitoxin pairs may occur in a single species. [Cellular processes, Toxin production and resistance, Mobile and extrachromosomal element functions, Other] |
| Pubmed ID |
30796087
|
| Domain |
CDD:412776 |
| Functional Category |
Conserved domain based functional assignment |
| Uniprot ID |
|
| ORF Length (Amino Acid) |
90 |