Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01223 |
NCBI Accession ID | NC_017340.1 |
Organism | Staphylococcus aureus 04-02981 |
Left | 2675718 |
Right | 2675993 |
Strand | - |
Nucleotide Sequence | ATGAGTACAGTTCAAAGTGATATTTTCAAGACTAATAGTGCATCATCATCTATTAAAAGTGCCGTTGAAACATGTAATAATGTGTCGAAACCGGATAAAGATGAAAGTACAACAGTAAGTGGAAATAATAATGCTCATAGTGTGATAGACGATTTGATTAGTAAGAATCAATCTGTTGCTGAAGCAATAAGAAATGCGAGCGATAGTATACAAAAAGTTGGCGAAGAATTTAATCAAACAGACGTAATGATTGGTAATGAAATTGGTAAAAATTAA |
Sequence | MSTVQSDIFKTNSASSSIKSAVETCNNVSKPDKDESTTVSGNNNAHSVIDDLISKNQSVAEAIRNASDSIQKVGEEFNQTDVMIGNEIGKN |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of cl27830. Profile Description: Protein of unknown function (DUF3130. Members of this protein family are similar in length and sequence (although remotely) to the WXG100 family of type VII secretion system (T7SS) targets, described by family TIGR03930. Phylogenetic profiling shows that members of this family are similarly restricted to species with T7SS, marking this family as a related set of T7SS effectors. Members include SACOL2603 from Staphylococcus aureus subsp. aureus COL. Oddly, members of family pfam10824 (DUF2580), which appears also to be related, seem not to be tied to T7SS. |
Pubmed ID | 30796087 |
Domain | CDD:332651 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 91 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2674777 | 2675052 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
2 | 2635857 | 2636132 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
3 | 1721220 | 1721492 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
4 | 1401299 | 1401586 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13780.8 | 0.75 | 3 | 371 | same-strand | Domain of unknown function (DUF4176) |