Result : EXP01222
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01222 |
| NCBI Accession ID | NZ_CP009472.1 |
| Organism | Lactococcus lactis strain AI06 |
| Left | 789514 |
| Right | 789783 |
| Strand | + |
| Nucleotide Sequence | TTGGAGGAAAAAATGGATAACCAAAATCAAGAAATAGGAAAAATTGTTGACATTCGTGAAAAAGTTCAAGCACACTTGGGTGAAACGATTGAAATTACTTCACAATTTGGTCGTAAACGCGAAAATCGTCATAAAGTGAACTTGATTGAAGCCTATGCAACACATTTCATTATTGAAAACATTCCGGCTCGTGGTCCCAAAACAACTGAGTCATATCAATATGCTGACATTTTGACTCAAACTATTTTAATTCATTATCCAAACGCATAA |
| Sequence | LEEKMDNQNQEIGKIVDIREKVQAHLGETIEITSQFGRKRENRHKVNLIEAYATHFIIENIPARGPKTTESYQYADILTQTILIHYPNA |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl01852. Profile Description: Biofilm formation stimulator VEG. VEG is a family that is highly conserved among Gram-positive bacteria. It stimulates biofilm formation through inducing transcription of the tapA-sipW-tasA operon. The products of this operon are resposible for production of the amyloid fibre (TasA) component of the biofilm. Veg or a Veg-induced protein acts as an antirepressor of SinR - part of the major overall biofilm transcriptional control system - to regulate and stimulate biofilm formation. Veg is transcribed at high levels during both exponential growth and sporulation. |
| Pubmed ID | 30796087 |
| Domain | CDD:413095 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 699429 | 699698 | + | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 2 | 832205 | 832474 | + | NZ_CP070872.1 | Lactococcus taiwanensis |
| 3 | 335693 | 335950 | + | NZ_CP032627.1 | Lactococcus allomyrinae |
| 4 | 1003146 | 1003421 | + | NZ_CP065637.1 | Lactococcus garvieae |
| 5 | 603204 | 603452 | + | NZ_CP017194.1 | Lactococcus carnosus |
| 6 | 622331 | 622579 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
| 7 | 1695276 | 1695524 | + | NZ_CP023392.1 | Lactococcus raffinolactis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_022369.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13419.8 | 1.0 | 7 | 4084 | same-strand | Haloacid dehalogenase-like hydrolase |
| 2 | PF01368.22 | 1.0 | 7 | 2009 | same-strand | DHH family |
| 3 | PF02272.21 | 1.0 | 7 | 2009 | same-strand | DHHA1 domain |
| 4 | PF03948.16 | 1.0 | 7 | 1475 | same-strand | Ribosomal protein L9, C-terminal domain |
| 5 | PF01281.21 | 1.0 | 7 | 1475 | same-strand | Ribosomal protein L9, N-terminal domain |
| 6 | PF03796.17 | 1.0 | 7 | 100 | same-strand | DnaB-like helicase C terminal domain |
| 7 | PF00772.23 | 1.0 | 7 | 100 | same-strand | DnaB-like helicase N terminal domain |
| 8 | PF13481.8 | 1.0 | 7 | 100 | same-strand | AAA domain |
| 9 | PF02390.19 | 1.0 | 7 | 971 | same-strand | Putative methyltransferase |
| 10 | PF03477.18 | 1.0 | 7 | 1658 | same-strand | ATP cone domain |
| 11 | PF07261.13 | 1.0 | 7 | 2143 | same-strand | Replication initiation and membrane attachment |
| 12 | PF07319.13 | 1.0 | 7 | 3309 | same-strand | Primosomal protein DnaI N-terminus |
++ More..