Result : B2KCQ1

Protein Information

• Protein name: 30S ribosomal protein S16
• NCBI Accession ID: CP001055.1
• Organism: Elusimicrobium minutum (strain Pei191)
• Left: 814148
• Right: 814396
• Strand: -
• Nucleotide Sequence: ATGGCAGTAGTACTTAGATTACAAAGAGTTGGTAAAAAGCAGCAACCGCAGTACAGAATTGTAGCTATCGAAAAAAAGAGCGCAGTAGGCTCCGAAGCTAAAGAAGTTGTAGGTCATTACAACCCCTGCAATGCTAAAGCAGCAGATCAGATTAAACTTAATCAAGAAAGATATGATTATTGGGTTAAAGTGGGTGCAAAAGCTTCTCCGACAGTGGCGGCACTTGCAAAAAAAGCTTCCGCTAAATAA
• Sequence: MAVVLRLQRVGKKQQPQYRIVAIEKKSAVGSEAKEVVGHYNPCNAKAADQIKLNQERYDYWVKVGAKASPTVAALAKKASAK
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of cl00368. Profile Description: Ribosomal protein S16. This model describes ribosomal S16 of bacteria and organelles. [Protein synthesis, Ribosomal proteins: synthesis and modification]
• Pubmed ID: 19270133
• Domain: CDD:412339
• Functional Category: Ribosomal_protein
• Uniprot ID: B2KCQ1
• ORF Length (Amino Acid): 82

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	814148	814396	-	NC_010644.1	Elusimicrobium minutum Pei191
2	1253347	1253604	-	NZ_CP037899.1	Methylacidiphilum kamchatkense Kam1

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_010644.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF01245.22	1.0	2	890.5	same-strand	Ribosomal protein L19
2	PF01746.23	1.0	2	175.5	same-strand	tRNA (Guanine-1)-methyltransferase