ProsmORF-pred
Result : A0A0H3NGF1
Protein Information
Information Type Description
Protein name Transcription modulator YdgT (H-NS/StpA-binding protein 2) (OriC-binding nucleoid-associated protein)
NCBI Accession ID FQ312003.1
Organism Salmonella typhimurium (strain SL1344)
Left 1492387
Right 1492617
Strand -
Nucleotide Sequence ATGGATCAACTTTATATGACTGTTCAGGATTATCTATTAAAATTCCGCAAAATTAGTTCGCTCGAAAGTCTGGAAAAACTGTTCGACCACCTTAACTATACCCTTACTGATGACATGGACATTGTTAATATGTATCGCGCTGCAGATCACCGCCGTGCCGAACTGGTTTCCGGAGGACGCCTGTTTGATGTAGGTCAGGTTCCGCAATCCGTCTGGCGCTATGTGCAATAA
Sequence MDQLYMTVQDYLLKFRKISSLESLEKLFDHLNYTLTDDMDIVNMYRAADHRRAELVSGGRLFDVGQVPQSVWRYVQ
Source of smORF Swiss-Prot
Function Binds to H-NS and modifies the range of genes it silences; H-NS alone silences 'core' genes while the H-NS-Hha complex (and presumably also H-NS-YdgT) silences genes acquired by horizontal gene transfer (Pubmed:19521501). Plays a role silencing virulence factors in the absence of factors that induce pathogenicity (Pubmed:17307861). {ECO:0000305|Pubmed:19521501}.
Pubmed ID 22538806 17307861 19521501
Domain CDD:416300
Functional Category DNA-binding
Uniprot ID A0A0H3NGF1
ORF Length (Amino Acid) 76
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 107
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1535526 1535756 - NC_003197.2 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
2 3924744 3924959 - NZ_CP053416.1 Salmonella bongori
3 1540380 1540595 - NC_013716.1 Citrobacter rodentium ICC168
4 3306738 3306953 + NZ_CP045205.1 Citrobacter telavivensis
5 87467 87682 + NZ_CP044098.1 Citrobacter portucalensis
6 3682112 3682327 - NZ_LT556085.1 Citrobacter amalonaticus
7 835809 836024 - NZ_CP038469.1 Citrobacter tructae
8 1642890 1643105 + NZ_AP014857.1 Escherichia albertii
9 4971996 4972211 - NZ_CP033744.1 Citrobacter freundii
10 1577023 1577238 + NC_009792.1 Citrobacter koseri ATCC BAA-895
11 2559903 2560118 - NZ_CP050508.1 Raoultella terrigena
12 4772891 4773106 + NZ_CP026047.1 Raoultella planticola
13 1406535 1406750 + NZ_CP027107.1 Cronobacter sakazakii
14 2497626 2497841 - NZ_CP046672.1 Raoultella ornithinolytica
15 2052072 2052287 - NZ_CP054058.1 Scandinavium goeteborgense
16 2186781 2186996 + NZ_CP013940.1 Cronobacter malonaticus LMG 23826
17 445610 445825 - NZ_CP057657.1 Escherichia fergusonii
18 2360968 2361183 - NZ_CP041247.1 Raoultella electrica
19 1981957 1982172 - NZ_CP012257.1 Cronobacter universalis NCTC 9529
20 2030460 2030675 - NZ_CP012266.1 Cronobacter dublinensis subsp. dublinensis LMG 23823
21 2990855 2991070 + NZ_CP014007.2 Kosakonia oryzae
22 2143853 2144068 - NZ_CP015113.1 Kosakonia radicincitans
23 1918155 1918370 - NZ_CP061527.1 Shigella dysenteriae
24 1681667 1681882 + NC_004337.2 Shigella flexneri 2a str. 301
25 1704949 1705164 + NC_000913.3 Escherichia coli str. K-12 substr. MG1655
26 2304717 2304932 + NC_002695.2 Escherichia coli O157:H7 str. Sakai
27 2761364 2761579 - NZ_CP051548.1 Phytobacter diazotrophicus
28 1499779 1499994 - NZ_CP011602.1 Phytobacter ursingii
29 2031932 2032147 + NZ_CP012268.1 Cronobacter muytjensii ATCC 51329
30 1975399 1975614 - NZ_CP012264.1 Cronobacter condimenti 1330
31 2644552 2644767 - NZ_CP060111.1 Klebsiella michiganensis
32 2718016 2718231 - NZ_CP036175.1 Klebsiella huaxiensis
33 2842697 2842912 + NZ_LR134475.1 Klebsiella aerogenes
34 940508 940723 + NZ_CP016337.1 Kosakonia sacchari
35 2188596 2188811 - NZ_CP063425.1 Kosakonia pseudosacchari
36 2103791 2104006 - NZ_LR134340.1 Escherichia marmotae
37 2015178 2015393 - NZ_AP022508.1 Enterobacter bugandensis
38 513443 513658 + NZ_CP025034.2 Enterobacter sp. SGAir0187
39 2032734 2032949 - NZ_CP009756.1 Enterobacter cloacae
40 2249149 2249364 - NZ_CP043318.1 Enterobacter chengduensis
41 1986369 1986584 - NC_015968.1 Enterobacter soli
42 1422775 1422990 + NZ_CP045769.1 Enterobacter cancerogenus
43 1959392 1959607 - NZ_CP017184.1 Enterobacter roggenkampii
44 1244476 1244691 - NZ_CP017279.1 Enterobacter ludwigii
45 2040685 2040900 - NZ_CP027986.1 Enterobacter sichuanensis
46 2940323 2940538 + NC_016845.1 Klebsiella pneumoniae subsp. pneumoniae HS11286
47 901336 901551 - NZ_CP023529.1 Lelliottia amnigena
48 2566351 2566566 + NZ_CP035129.1 Kosakonia cowanii
49 55761 55976 - NZ_AP019007.1 Enterobacter oligotrophicus
50 2382828 2383043 - NZ_CP054254.1 Klebsiella variicola
51 2300601 2300816 - NZ_CP065838.1 Klebsiella quasipneumoniae
52 2426589 2426804 + NZ_CP012871.1 [Enterobacter] lignolyticus
53 2374563 2374760 - NZ_CP038498.1 Pectobacterium punjabense
54 4156379 4156576 - NZ_CP015750.1 Pectobacterium wasabiae CFBP 3304
55 2438086 2438301 + NZ_CP045845.1 Kluyvera intermedia
56 2688910 2689125 + NZ_CP013990.1 Leclercia adecarboxylata
57 1586004 1586201 + NZ_CP015749.1 Pectobacterium parmentieri
58 1848557 1848772 - NZ_LN907827.1 Erwinia gerundensis
59 2203139 2203354 - NC_014306.1 Erwinia billingiae Eb661
60 3813698 3813913 + NZ_CP020388.1 Pluralibacter gergoviae
61 3721702 3721917 - NZ_CP042941.1 Atlantibacter hermannii
62 1274727 1274942 - NZ_CP028271.1 Mixta intestinalis
63 3784080 3784295 + NZ_CP019706.1 Pantoea alhagi
64 2446435 2446650 - NZ_CP065044.1 Pectobacterium aroidearum
65 2140846 2141061 - NZ_CP026377.1 Mixta gaviniae
66 2320115 2320330 + NZ_CP006569.1 Sodalis praecaptivus
67 238823 239038 - NZ_CP049115.1 Pantoea stewartii
68 2479051 2479266 + NC_012912.1 Dickeya chrysanthemi Ech1591
69 2082643 2082858 - NZ_CP061511.1 Mixta calida
70 2321635 2321856 + NC_017910.1 Shimwellia blattae DSM 4481 = NBRC 105725
71 2523576 2523791 + NC_017554.1 Pantoea ananatis PA13
72 1182907 1183104 - NZ_CP017482.1 Pectobacterium polaris
73 2107420 2107635 - NZ_AP023184.1 Buttiauxella agrestis
74 384142 384357 + NZ_CP009460.1 Dickeya fangzhongdai
75 2320763 2320978 - NZ_CP025799.1 Dickeya zeae
76 2192627 2192842 + NZ_CP038853.1 Pantoea vagans
77 2380845 2381060 - NC_014500.1 Dickeya dadantii 3937
78 4532134 4532349 - NZ_CP015137.1 Dickeya solani IPO 2222
79 2333198 2333413 + NZ_CP050150.1 Hafnia alvei
80 1862561 1862776 - NZ_CP034148.1 Pantoea agglomerans
81 2195548 2195763 + NZ_CP045720.1 Pantoea eucalypti
82 2510982 2511179 + NZ_CP034938.1 Pectobacterium odoriferum
83 1769634 1769831 + NZ_CP014137.1 Brenneria goodwinii
84 3963435 3963650 - NZ_CP047495.1 Pectobacterium brasiliense
85 2604814 2605008 + NZ_LR134201.1 Cedecea lapagei
86 2835891 2836085 + NZ_CP023525.1 Cedecea neteri
87 2182745 2182960 + NZ_CP042220.2 Dickeya poaceiphila
88 2417890 2418105 + NZ_CP051652.1 Pectobacterium carotovorum
89 2247755 2247970 + NZ_LT615367.1 Dickeya aquatica
90 2281713 2281928 + NC_012880.1 Musicola paradisiaca Ech703
91 3762799 3763014 - NZ_CP006664.1 Edwardsiella anguillarum ET080813
92 3515743 3515958 - NZ_CP023706.1 Edwardsiella tarda
93 1845671 1845886 - NZ_CP016043.1 Edwardsiella hoshinae
94 5417753 5417944 + NZ_CP011254.1 Serratia fonticola
95 4185920 4186111 + NZ_CP007044.2 Chania multitudinisentens RB-25
96 3174666 3174857 + NZ_LT906479.1 Serratia ficaria
97 1954314 1954529 - NZ_CP071320.1 Serratia ureilytica
98 2444202 2444417 + NZ_CP016948.1 Serratia surfactantfaciens
99 3145509 3145724 + NZ_CP038662.1 Serratia nematodiphila
100 3260790 3260981 + NZ_CP048784.1 Serratia liquefaciens
101 3289419 3289610 + NZ_LR134494.1 Serratia quinivorans
102 3272772 3272963 + NC_015567.1 Serratia plymuthica AS9
103 1406372 1406584 - NZ_LS483470.1 Leminorella richardii
104 4953670 4953861 - NZ_CP014136.1 Gibbsiella quercinecans
105 4510957 4511148 + NZ_CP065640.1 Serratia rubidaea
106 1382961 1383173 - NZ_CP029185.2 Limnobaculum parvum
107 2551941 2552153 + NZ_LR134531.1 Pragia fontium
108 1260101 1260313 + NZ_CP034752.1 Jinshanibacter zhutongyuii
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_003197.2
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF03116.17 0.79 85 3886.5 same-strand NQR2, RnfD, RnfE family
2 PF01512.19 0.85 91 1756.0 same-strand Respiratory-chain NADH dehydrogenase 51 Kd subunit
3 PF13375.8 0.84 90 1756 same-strand RnfC Barrel sandwich hybrid domain
4 PF10531.11 0.84 90 1756 same-strand SLBB domain
5 PF12838.9 0.84 90 1755.0 same-strand 4Fe-4S dicluster domain
6 PF13237.8 0.86 92 1369.0 same-strand 4Fe-4S dicluster domain
7 PF13187.8 0.86 92 1368.5 same-strand 4Fe-4S dicluster domain
8 PF13183.8 0.84 90 1756 same-strand 4Fe-4S dicluster domain
9 PF13534.8 0.8 86 1756 same-strand 4Fe-4S dicluster domain
10 PF14697.8 0.86 92 1232 same-strand 4Fe-4S dicluster domain
11 PF00037.29 0.86 92 1186 same-strand 4Fe-4S binding domain
12 PF04060.15 0.86 92 1185 same-strand Putative Fe-S cluster
13 PF12797.9 0.86 92 1186 same-strand 4Fe-4S binding domain
14 PF12837.9 0.86 92 1186.0 same-strand 4Fe-4S binding domain
15 PF02508.16 0.86 92 604 same-strand Rnf-Nqr subunit, membrane protein
16 PF10754.11 0.68 73 87.5 same-strand Protein of unknown function (DUF2569)
++ More..